(data stored in ACNUC7421 zone)

EMBL: CR954246.PE57

CR954246.PE57        Location/Qualifiers
FT   CDS             complement(64576..65067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0062"
FT                   /product="glutathione peroxidase possibly involved in
FT                   repair of phospholipid hydroperoxides"
FT                   /function="2.4.3 : Other"
FT                   /EC_number="1.11.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11418106; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85171"
FT                   /db_xref="GOA:Q3IDD8"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD8"
FT                   /protein_id="CAI85171.1"
FT                   /translation="MHKFHQLSATSLQGNTINFSEFAGKVVLIVNTASKCGFTYQYESL
FT                   QALHNKYASQGLVILGFPCNQFNQQEPGDAQQIEQGCLINYGVNFLMAAKVEVNGEHAH
FT                   PVFRYLKSTQPGFLTRKIKWNFTKFLIAADGSPIKRYAPFTKPEKLELTIQKALQQSNK
FT                   "
     MHKFHQLSAT SLQGNTINFS EFAGKVVLIV NTASKCGFTY QYESLQALHN KYASQGLVIL        60
     GFPCNQFNQQ EPGDAQQIEQ GCLINYGVNF LMAAKVEVNG EHAHPVFRYL KSTQPGFLTR       120
     KIKWNFTKFL IAADGSPIKR YAPFTKPEKL ELTIQKALQQ SNK                         163
//

If you have problems or comments...

PBIL Back to PBIL home page