(data stored in ACNUC7421 zone)

EMBL: CR954246.PE59

CR954246.PE59        Location/Qualifiers
FT   CDS             complement(65455..66117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0064"
FT                   /product="putative amino acid permease"
FT                   /function="1.2.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0064"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85173"
FT                   /db_xref="GOA:Q3IDD6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD6"
FT                   /protein_id="CAI85173.1"
FT                   /translation="MLPLCLAVIPWGILCGSLAIQNGFTALETQAMSLLVFAGSAQLVA
FT                   IELIAGNTPLLTILFTTFIISSRHFLYGLAVRHKVIDQPLRWRLPVSFVLTDELFAFSH
FT                   HPKAYRTKIRLIYALSAGFSFYIAWNLWTFIGIVAGTMLPDLTHLGLDFAIAATFIALV
FT                   IPGVKSLASLVTVIVAGISATLFKSTGFELWLVSSALLAMSAGYFTARITAKKERNL"
     MLPLCLAVIP WGILCGSLAI QNGFTALETQ AMSLLVFAGS AQLVAIELIA GNTPLLTILF        60
     TTFIISSRHF LYGLAVRHKV IDQPLRWRLP VSFVLTDELF AFSHHPKAYR TKIRLIYALS       120
     AGFSFYIAWN LWTFIGIVAG TMLPDLTHLG LDFAIAATFI ALVIPGVKSL ASLVTVIVAG       180
     ISATLFKSTG FELWLVSSAL LAMSAGYFTA RITAKKERNL                             220
//

If you have problems or comments...

PBIL Back to PBIL home page