(data stored in ACNUC7421 zone)

EMBL: CR954246.PE60

CR954246.PE60        Location/Qualifiers
FT   CDS             66290..66949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0065"
FT                   /product="putative cytochrome"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0065"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85174"
FT                   /db_xref="GOA:Q3IF97"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF97"
FT                   /protein_id="CAI85174.1"
FT                   /translation="MFKVKVWDGFVRSFHWLLVFSIAVLYFSIEEGMIELHFIAGFFTL
FT                   ALILTRLIWGIIGSKTAKLSALIHSPQAVITSLKANKTPLGHSAPGSYMVLLFFILIIT
FT                   QLVSGLMSSDGILTDGPLAQYVSSSTVDFANWLHSLNFDILLYAIGLHVLAIVIYKIKG
FT                   KPLVKAMITGTKQQPNEKPAILTKAPWLAWVVFLILLVVLMTTWGSEPLSYLLNLG"
     MFKVKVWDGF VRSFHWLLVF SIAVLYFSIE EGMIELHFIA GFFTLALILT RLIWGIIGSK        60
     TAKLSALIHS PQAVITSLKA NKTPLGHSAP GSYMVLLFFI LIITQLVSGL MSSDGILTDG       120
     PLAQYVSSST VDFANWLHSL NFDILLYAIG LHVLAIVIYK IKGKPLVKAM ITGTKQQPNE       180
     KPAILTKAPW LAWVVFLILL VVLMTTWGSE PLSYLLNLG                              219
//

If you have problems or comments...

PBIL Back to PBIL home page