(data stored in ACNUC7421 zone)

EMBL: CR954246.PE61

CR954246.PE61        Location/Qualifiers
FT   CDS             complement(67014..67466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0066"
FT                   /product="conserved protein of unknown function ; putative
FT                   cytochrome c'"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85175"
FT                   /db_xref="GOA:Q3IF96"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF96"
FT                   /protein_id="CAI85175.1"
FT                   /translation="MKLKQVFIGALLSTCALSVSANSAFKEPSDAIEYRQAAFSMLSVQ
FT                   ISDMGAMLKGKIPFDADKFKARANNAAALAKMPWEAFYEGTDKGDTAALAAVWAENDTF
FT                   MKKATAFQQYADELAVAAQSGDKAVIGKAFGAWAKGCKDCHTQFKD"
     MKLKQVFIGA LLSTCALSVS ANSAFKEPSD AIEYRQAAFS MLSVQISDMG AMLKGKIPFD        60
     ADKFKARANN AAALAKMPWE AFYEGTDKGD TAALAAVWAE NDTFMKKATA FQQYADELAV       120
     AAQSGDKAVI GKAFGAWAKG CKDCHTQFKD                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page