(data stored in ACNUC7421 zone)

EMBL: CR954246.PE62

CR954246.PE62        Location/Qualifiers
FT   CDS             complement(67561..68031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0067"
FT                   /product="putative integral membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85176"
FT                   /db_xref="GOA:Q3IF95"
FT                   /db_xref="InterPro:IPR021279"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF95"
FT                   /protein_id="CAI85176.1"
FT                   /translation="MDNEVINILSMAKVIQTAVAPVFLITGIAATLGVLSNRLARITDR
FT                   ARLLERRLKVSTDDDFNLSLTTELRALLKRSRCIHLAFSLSVLSALLVCAVVMLLFLSH
FT                   IQSVNLGVTIGSCFVAAMALLIFAFMSLLCEVFLATRSMRRGMIFADVDIND"
     MDNEVINILS MAKVIQTAVA PVFLITGIAA TLGVLSNRLA RITDRARLLE RRLKVSTDDD        60
     FNLSLTTELR ALLKRSRCIH LAFSLSVLSA LLVCAVVMLL FLSHIQSVNL GVTIGSCFVA       120
     AMALLIFAFM SLLCEVFLAT RSMRRGMIFA DVDIND                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page