(data stored in ACNUC7421 zone)

EMBL: CR954246.PE63

CR954246.PE63        Location/Qualifiers
FT   CDS             68256..71720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0068"
FT                   /product="putative serine secreted endoprotease, subtilase
FT                   family"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85177"
FT                   /db_xref="GOA:Q3IF94"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF94"
FT                   /protein_id="CAI85177.1"
FT                   /translation="MSKNIIKKTAIATAVSSAFIATLASASNLPTANITYQKAEAVKEQ
FT                   VADKKEPSAHMIVLRATTSVDAYVAGTYQQSNNREITANIEQLQDTMTLELNSLDFDAK
FT                   IIGKTKILAPTLIVQASAEALAKIAKDSRVAKVLPMFDSELHVAASSDYINAKPLIVDG
FT                   IASGKGQRVAVLDTGIDYTHQAFGGAGTVEAYLAAQADPTTVAWPQGVVKGGYDFINED
FT                   ADPIENDPANSPATGAPTNHGTSSSNSVNGIAPDVELYVYSVCGGGCPSAAQAAALEAA
FT                   MDPNGDGDISDRVDVMNMSLGGEFGDTYTGGGTQYLIQRAVELGVNMVISAGNDGDNPF
FT                   RIGGPSTTPNALSVGAMTHPTTEIGVATGTIAGVEGDIQPSSFGPQEAYTITGADIELV
FT                   YPDANQNGCVAFAADVDFTGKAVLIDRGACAFTDKVLNAQINGAEFVMIANNTDDGTPA
FT                   PMGGFDAAVTIKNVGINFAAGAALKAQLAAGGPATFDISIDIKTTSGAVATFSSRGPSM
FT                   DGLLKPEITAPGTSIDVAAAGTQTGTNPVSGTSFSGPITAGAVAMIREAHPDRNAFEIK
FT                   ATIMNAANLNVTNEPLAINPASELAPISMIGAGLVDVAKAVNLPVAAWVNNAKFNTKQA
FT                   ALSFGLESMTETASLTKTVTVKNFSADAKTYNLRTEARYQSDIDTAAISWDFPASITVP
FT                   AGQAINFDVVLTVDPAKLPEWNLNNPFSAEEVAARSAALTSVEFDGALVFDDASTDTDH
FT                   DLHLVYHAMPKAATELSVSSQIVDSEMALVVTNSGQTEIMPQAESIVAVGVEKTFAEAE
FT                   FNILATTFSAFNAEFCDSGIFVTSSIQLRDPLTHTFQAGYRLEIDTDNDGVADQFMTNL
FT                   NDRGRDTAFPGRSRTLIGETDGAGNDSWAWGTPLYHSAGEDTITFSGCSELLNIDGTLL
FT                   GEQMNFKASVGYAAYQSGVFTETDSVTGSTVFGMQPQVAFTSLETGEAVTTLKPGEKAV
FT                   VTASGPFALTQASGLDVVKVMAAADLEVPDVSAPALVGGEFTVSEDAANGTVVGALTVT
FT                   ESEFDLAISEYFVQSNTHQGLGVDADGQVVVTNTALLTGDSSAQIQVVAIDTRGNVSEP
FT                   AIVTVSITKVVPPPVVVTPEPEKKSSGSLAWLLLTAPLAFMRRRKQK"
     MSKNIIKKTA IATAVSSAFI ATLASASNLP TANITYQKAE AVKEQVADKK EPSAHMIVLR        60
     ATTSVDAYVA GTYQQSNNRE ITANIEQLQD TMTLELNSLD FDAKIIGKTK ILAPTLIVQA       120
     SAEALAKIAK DSRVAKVLPM FDSELHVAAS SDYINAKPLI VDGIASGKGQ RVAVLDTGID       180
     YTHQAFGGAG TVEAYLAAQA DPTTVAWPQG VVKGGYDFIN EDADPIENDP ANSPATGAPT       240
     NHGTSSSNSV NGIAPDVELY VYSVCGGGCP SAAQAAALEA AMDPNGDGDI SDRVDVMNMS       300
     LGGEFGDTYT GGGTQYLIQR AVELGVNMVI SAGNDGDNPF RIGGPSTTPN ALSVGAMTHP       360
     TTEIGVATGT IAGVEGDIQP SSFGPQEAYT ITGADIELVY PDANQNGCVA FAADVDFTGK       420
     AVLIDRGACA FTDKVLNAQI NGAEFVMIAN NTDDGTPAPM GGFDAAVTIK NVGINFAAGA       480
     ALKAQLAAGG PATFDISIDI KTTSGAVATF SSRGPSMDGL LKPEITAPGT SIDVAAAGTQ       540
     TGTNPVSGTS FSGPITAGAV AMIREAHPDR NAFEIKATIM NAANLNVTNE PLAINPASEL       600
     APISMIGAGL VDVAKAVNLP VAAWVNNAKF NTKQAALSFG LESMTETASL TKTVTVKNFS       660
     ADAKTYNLRT EARYQSDIDT AAISWDFPAS ITVPAGQAIN FDVVLTVDPA KLPEWNLNNP       720
     FSAEEVAARS AALTSVEFDG ALVFDDASTD TDHDLHLVYH AMPKAATELS VSSQIVDSEM       780
     ALVVTNSGQT EIMPQAESIV AVGVEKTFAE AEFNILATTF SAFNAEFCDS GIFVTSSIQL       840
     RDPLTHTFQA GYRLEIDTDN DGVADQFMTN LNDRGRDTAF PGRSRTLIGE TDGAGNDSWA       900
     WGTPLYHSAG EDTITFSGCS ELLNIDGTLL GEQMNFKASV GYAAYQSGVF TETDSVTGST       960
     VFGMQPQVAF TSLETGEAVT TLKPGEKAVV TASGPFALTQ ASGLDVVKVM AAADLEVPDV      1020
     SAPALVGGEF TVSEDAANGT VVGALTVTES EFDLAISEYF VQSNTHQGLG VDADGQVVVT      1080
     NTALLTGDSS AQIQVVAIDT RGNVSEPAIV TVSITKVVPP PVVVTPEPEK KSSGSLAWLL      1140
     LTAPLAFMRR RKQK                                                        1154
//

If you have problems or comments...

PBIL Back to PBIL home page