(data stored in ACNUC7421 zone)

EMBL: CR954246.PE65

CR954246.PE65        Location/Qualifiers
FT   CDS             74144..74509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0070"
FT                   /product="conserved protein of unknown function ; putative
FT                   inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85179"
FT                   /db_xref="GOA:Q3IF92"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF92"
FT                   /protein_id="CAI85179.1"
FT                   /translation="MHDEQQLEPVKKDDRTWAMLCHLSALSGFIVPLGSVIGPLIVWLI
FT                   KKDDMPIVDVHGKKALNFQITMMIAYFVCFLLMFVVIGVILLPIVAIFSFVMVIIAAVK
FT                   ANDGKEFDYPLSLNLIK"
     MHDEQQLEPV KKDDRTWAML CHLSALSGFI VPLGSVIGPL IVWLIKKDDM PIVDVHGKKA        60
     LNFQITMMIA YFVCFLLMFV VIGVILLPIV AIFSFVMVII AAVKANDGKE FDYPLSLNLI       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page