(data stored in ACNUC7421 zone)

EMBL: CR954246.PE66

CR954246.PE66        Location/Qualifiers
FT   CDS             74593..75027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0071"
FT                   /product="conserved protein of unknown function ; protein
FT                   similar to E. coli YqaA"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85180"
FT                   /db_xref="GOA:Q3IF91"
FT                   /db_xref="InterPro:IPR020143"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF91"
FT                   /protein_id="CAI85180.1"
FT                   /translation="MLYLTLFISAFISATLLPSSSEVVMVAMMTQGKVNLLLLWLAATL
FT                   GNVLGSCVNYWLGTQVLRFKDKSWFPVSEQGLEKAQKQFNKYGVYSLLFAWLPIVGDPL
FT                   TVIGGIFKVRFSTFLLLVTLGKGARYLAVIALTLGVEKLI"
     MLYLTLFISA FISATLLPSS SEVVMVAMMT QGKVNLLLLW LAATLGNVLG SCVNYWLGTQ        60
     VLRFKDKSWF PVSEQGLEKA QKQFNKYGVY SLLFAWLPIV GDPLTVIGGI FKVRFSTFLL       120
     LVTLGKGARY LAVIALTLGV EKLI                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page