(data stored in ACNUC7421 zone)

EMBL: CR954246.PE7

CR954246.PE7         Location/Qualifiers
FT   CDS             9419..9871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0007"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85121"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ27"
FT                   /protein_id="CAI85121.1"
FT                   /translation="MKSPIKRILTLALVSFLTACSTQITLDDVLPQQKLDRTVYLRGDF
FT                   TLWDAEPQYQFTQVARSLYQAEVKFSTPGKVYEFKIADADFSEGYNCGYSDTQPAGQKL
FT                   TLGQPAVADCNTIYNYFSYTPAIKGTYIVSIDYSNYDKPQVTITKK"
     MKSPIKRILT LALVSFLTAC STQITLDDVL PQQKLDRTVY LRGDFTLWDA EPQYQFTQVA        60
     RSLYQAEVKF STPGKVYEFK IADADFSEGY NCGYSDTQPA GQKLTLGQPA VADCNTIYNY       120
     FSYTPAIKGT YIVSIDYSNY DKPQVTITKK                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page