(data stored in ACNUC7421 zone)

EMBL: CR954246.PE71

CR954246.PE71        Location/Qualifiers
FT   CDS             complement(77760..78389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0076"
FT                   /product="conserved protein of unknown function similar to
FT                   YceH of E. coli"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85185"
FT                   /db_xref="InterPro:IPR007432"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF86"
FT                   /protein_id="CAI85185.1"
FT                   /translation="MQLSANQQRIIGCLLEKQSTTPEHYPLSLNALTNACNQKSNRAPV
FT                   LNLTDSEVQIALDELINARLVTIDEGLSGRVNKYDHRFCNTEFSSLKFSAQQRAIICLL
FT                   LLRGAQTPGELKTRCARLANFNSVDDVELALNKLIESDIVTKLAREPGKRDCRYMHLLG
FT                   EQPISEITRPAEQATDELKSEELNELLAEVDELKTELQKIKAHLGL"
     MQLSANQQRI IGCLLEKQST TPEHYPLSLN ALTNACNQKS NRAPVLNLTD SEVQIALDEL        60
     INARLVTIDE GLSGRVNKYD HRFCNTEFSS LKFSAQQRAI ICLLLLRGAQ TPGELKTRCA       120
     RLANFNSVDD VELALNKLIE SDIVTKLARE PGKRDCRYMH LLGEQPISEI TRPAEQATDE       180
     LKSEELNELL AEVDELKTEL QKIKAHLGL                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page