(data stored in ACNUC7421 zone)

EMBL: CR954246.PE72

CR954246.PE72        Location/Qualifiers
FT   CDS             complement(78431..81793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0077"
FT                   /product="putative sensor protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85186"
FT                   /db_xref="GOA:Q3IF85"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF85"
FT                   /protein_id="CAI85186.1"
FT                   /translation="MSPMNNSKNNKVHNFKLTFWLSLTLIVLVSVVLDRINYNREKDAH
FT                   RLQILSEVSTYRAQLEAILVSNIQLIRGLGVAVAAEPNLQQARFAQIAAPLFETSNELR
FT                   NIGGAPDMVINMIYPLAGNEQALGLNFLDNEAQRIDAIRARDTNKIVMAGPLTLIQGGS
FT                   ALIARVPVYKADKSFWGLLSVVLDLEKVYANAGINELEKQYNVAIQGRHGLGTKGDFFY
FT                   GEPAIIEQDPLEFSLSFQGGNWQLYVAPKKGWSPVSSSIWPLRVAIIIICGLLIWAFLF
FT                   FLKMFNRQQQNEKMLEVMSDLALVGAWSFNLENKQAYWSDMTKKIFKYSPDEQPQWPKD
FT                   LGYFKPGKSREKAAKLIERAIKFGESYEAELEVIDAKGNIIWVLVHGEAEHKNDRCIRI
FT                   FGSLQNIDTRKKIELENNKISLFNEALASLTVNDQILNGQLSQSKGVITQAICQALNVD
FT                   QASIWLFSDNRTQLKPIAFHNINTTTNNNNEPWLQKDIPDFFEAIEHKAIFSAADAQQC
FT                   PILMPIKEHYLKPLKINAMLCAVIPAGSGIIGMVCAEQCNTTRAWAHNEESFLIAVAAL
FT                   VGSLYSSQKRIETEQQLVTAKETAEQAVAAKSEFLASMSHEIRTPMNGVLGMLNIVKNT
FT                   KLDQQQMHHIELAQSSAQSLLNIINDILDFSKIEAGKLDIEKIQFNLPRLLGEVVESFA
FT                   LKAEQNNTILILDATLITVSEIVSDPNRLRQILSNLISNAVKFTFDGKIVVTAKIDETT
FT                   DGTSLVCSIIDTGIGIKPEKHSTLFDSFTQADTSTTRQYGGTGLGLAIVKQLCELMGGE
FT                   VSVTSMLNEGSTFSFSIKIKPKLSKQQDLPSHLIKNKHILIIDSCLLNSTIAKKQLIIW
FT                   QANANTLTDYTAVSAYFKDQATTTLDAILIDYYFFEQAPQSQITEVKNYLAKHSCKLII
FT                   MAPMSYSKDDSTLSLKVDSMIFKPLTPSDLFDSLANDKYIEQQQQQAQLQNKLTETPLV
FT                   NTNEPQVLLVEDNKINQVVAGALLKQAGISFDIAENGREAIKQLNEQPANTYQLILMDC
FT                   QMPEMDGYQATKAIRNGDSGKHYQNITIIALTANAMQGDKEKCLAAGMNDYLSKPLDFS
FT                   ALHPKLQQWLGTQ"
     MSPMNNSKNN KVHNFKLTFW LSLTLIVLVS VVLDRINYNR EKDAHRLQIL SEVSTYRAQL        60
     EAILVSNIQL IRGLGVAVAA EPNLQQARFA QIAAPLFETS NELRNIGGAP DMVINMIYPL       120
     AGNEQALGLN FLDNEAQRID AIRARDTNKI VMAGPLTLIQ GGSALIARVP VYKADKSFWG       180
     LLSVVLDLEK VYANAGINEL EKQYNVAIQG RHGLGTKGDF FYGEPAIIEQ DPLEFSLSFQ       240
     GGNWQLYVAP KKGWSPVSSS IWPLRVAIII ICGLLIWAFL FFLKMFNRQQ QNEKMLEVMS       300
     DLALVGAWSF NLENKQAYWS DMTKKIFKYS PDEQPQWPKD LGYFKPGKSR EKAAKLIERA       360
     IKFGESYEAE LEVIDAKGNI IWVLVHGEAE HKNDRCIRIF GSLQNIDTRK KIELENNKIS       420
     LFNEALASLT VNDQILNGQL SQSKGVITQA ICQALNVDQA SIWLFSDNRT QLKPIAFHNI       480
     NTTTNNNNEP WLQKDIPDFF EAIEHKAIFS AADAQQCPIL MPIKEHYLKP LKINAMLCAV       540
     IPAGSGIIGM VCAEQCNTTR AWAHNEESFL IAVAALVGSL YSSQKRIETE QQLVTAKETA       600
     EQAVAAKSEF LASMSHEIRT PMNGVLGMLN IVKNTKLDQQ QMHHIELAQS SAQSLLNIIN       660
     DILDFSKIEA GKLDIEKIQF NLPRLLGEVV ESFALKAEQN NTILILDATL ITVSEIVSDP       720
     NRLRQILSNL ISNAVKFTFD GKIVVTAKID ETTDGTSLVC SIIDTGIGIK PEKHSTLFDS       780
     FTQADTSTTR QYGGTGLGLA IVKQLCELMG GEVSVTSMLN EGSTFSFSIK IKPKLSKQQD       840
     LPSHLIKNKH ILIIDSCLLN STIAKKQLII WQANANTLTD YTAVSAYFKD QATTTLDAIL       900
     IDYYFFEQAP QSQITEVKNY LAKHSCKLII MAPMSYSKDD STLSLKVDSM IFKPLTPSDL       960
     FDSLANDKYI EQQQQQAQLQ NKLTETPLVN TNEPQVLLVE DNKINQVVAG ALLKQAGISF      1020
     DIAENGREAI KQLNEQPANT YQLILMDCQM PEMDGYQATK AIRNGDSGKH YQNITIIALT      1080
     ANAMQGDKEK CLAAGMNDYL SKPLDFSALH PKLQQWLGTQ                            1120
//

If you have problems or comments...

PBIL Back to PBIL home page