(data stored in ACNUC7421 zone)

EMBL: CR954246.PE73

CR954246.PE73        Location/Qualifiers
FT   CDS             complement(81911..83671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0078"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85187"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF84"
FT                   /protein_id="CAI85187.1"
FT                   /translation="MTDKTFIKGKDRDLESSISTMQNKLKALNINIEEALWLNPVANCY
FT                   SVHIRDQDCGVMFTNGKGANDKASLASALGEYFERLSCNYFFADFYLGEEFAHAEFTHY
FT                   PTEKWFTVTNDEVPEGIMDESLWDYFDPERELNASHLFDFNSGNVKRGICTVPYTRQSD
FT                   NQDVYIPVNVIGNIFVSNGMSAGNTKFEARVQGLSEVFERAIKSRIITEGLCLPIVPEE
FT                   VVKLYPKIYEACEELRSHGFHLRIADASLGGKYPVMSVTLIHPADGSVFASFGAHPSFE
FT                   VALERTVTELLQGRRLDQLDVFQPATFDNDEVASPENTELHFIDSSGLISHDFFRAKAD
FT                   FDFVHWDFSGTTEQEYNFCTDLIHSMGHDIYIMDYTHLNVYACRILVPGMSDIYPVDEL
FT                   IWRNNNEGAKFRETFLSLDQYDVEQWMEIYDSLEEAGHSDIIRAAEFIGLVTDPDTSWD
FT                   TLRIGELKAHLCLAAGNEEAIDWVDWILHTGQVNEDAMRHFRCLKAILEIKYDDEREYA
FT                   DYQDALGLMFGTANVTLAIEIAEGRKLFNGLTFPGLSLTGFTKHAALLDGYRKLHVAKQ
FT                   QHWAREVSDS"
     MTDKTFIKGK DRDLESSIST MQNKLKALNI NIEEALWLNP VANCYSVHIR DQDCGVMFTN        60
     GKGANDKASL ASALGEYFER LSCNYFFADF YLGEEFAHAE FTHYPTEKWF TVTNDEVPEG       120
     IMDESLWDYF DPERELNASH LFDFNSGNVK RGICTVPYTR QSDNQDVYIP VNVIGNIFVS       180
     NGMSAGNTKF EARVQGLSEV FERAIKSRII TEGLCLPIVP EEVVKLYPKI YEACEELRSH       240
     GFHLRIADAS LGGKYPVMSV TLIHPADGSV FASFGAHPSF EVALERTVTE LLQGRRLDQL       300
     DVFQPATFDN DEVASPENTE LHFIDSSGLI SHDFFRAKAD FDFVHWDFSG TTEQEYNFCT       360
     DLIHSMGHDI YIMDYTHLNV YACRILVPGM SDIYPVDELI WRNNNEGAKF RETFLSLDQY       420
     DVEQWMEIYD SLEEAGHSDI IRAAEFIGLV TDPDTSWDTL RIGELKAHLC LAAGNEEAID       480
     WVDWILHTGQ VNEDAMRHFR CLKAILEIKY DDEREYADYQ DALGLMFGTA NVTLAIEIAE       540
     GRKLFNGLTF PGLSLTGFTK HAALLDGYRK LHVAKQQHWA REVSDS                      586
//

If you have problems or comments...

PBIL Back to PBIL home page