(data stored in ACNUC7421 zone)

EMBL: CR954246.PE74

CR954246.PE74        Location/Qualifiers
FT   CDS             83828..86161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0079"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85188"
FT                   /db_xref="GOA:Q3IF83"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF83"
FT                   /protein_id="CAI85188.1"
FT                   /translation="MFKVIKRLLLLVVVLGLAGTAVVYGVLSLSLPALDGKGHSEAINE
FT                   PVIISRDVLGQAVIKAQSHNDAAYGLGYAHGQDRFFQMDLLRRNAAGELSEIFGKAALA
FT                   LDKKMRFHQLRKRSQVILKNLPESDKQLLKSYAQGVNEGLAQIGYSSFEYLLTGAQQRP
FT                   WQSEDSLLIIFSMYLDLQSATFERDQALIQIEQQYGKHMLKFLTQPSQYQAALDGSQLA
FT                   PYSAGIPKLPIPKQQTQQSSTVQSSTPAMYAFNSFAASQERGSNNWAVTGALTTTGAAM
FT                   LSDDMHLAMAVPVIWYKAQLNYVHNNVKTQVTGVSLPGAPAIVVGTNNHIAWGFTNGYI
FT                   DTADWVALTSNNKTWQVDEQIALPNNEAETYTLTLSEYGPVKYINGQAYALSWAAHQSY
FT                   AVNMQLLQLEQATEVDDALAIASDVGIPVQNLIVVDSQGSAAWKLMGGIPGRKTPSELS
FT                   VKSTDYSPLWLQNEAQRPVVKNPVSGRIWTANSRVVSAQDNERFGNGGYSLGARATQVR
FT                   DRLFEKQKFVEDDFYQLQLDNQARFLIPWHALLLKQLKADEGNNAAYISAVENWQQCAC
FT                   ASSVGYTLIKHYRDEVINITFSTLQQSLSEKNGTLSYVRRDLEPAVWQLINAQPSSWLN
FT                   PQFSTWEQQLQGAFSQTIAKLSTQYGNNIQGWQWGKVNELVIEHPFAKQIPILARFLNM
FT                   PKTPGFGDSYMPAVQGRSFGASQRFIVQPGHLENAILTVPGGQSGHPLSNFYRAGFSQY
FT                   INAENTPLLPQALVHQIIISPKGK"
     MFKVIKRLLL LVVVLGLAGT AVVYGVLSLS LPALDGKGHS EAINEPVIIS RDVLGQAVIK        60
     AQSHNDAAYG LGYAHGQDRF FQMDLLRRNA AGELSEIFGK AALALDKKMR FHQLRKRSQV       120
     ILKNLPESDK QLLKSYAQGV NEGLAQIGYS SFEYLLTGAQ QRPWQSEDSL LIIFSMYLDL       180
     QSATFERDQA LIQIEQQYGK HMLKFLTQPS QYQAALDGSQ LAPYSAGIPK LPIPKQQTQQ       240
     SSTVQSSTPA MYAFNSFAAS QERGSNNWAV TGALTTTGAA MLSDDMHLAM AVPVIWYKAQ       300
     LNYVHNNVKT QVTGVSLPGA PAIVVGTNNH IAWGFTNGYI DTADWVALTS NNKTWQVDEQ       360
     IALPNNEAET YTLTLSEYGP VKYINGQAYA LSWAAHQSYA VNMQLLQLEQ ATEVDDALAI       420
     ASDVGIPVQN LIVVDSQGSA AWKLMGGIPG RKTPSELSVK STDYSPLWLQ NEAQRPVVKN       480
     PVSGRIWTAN SRVVSAQDNE RFGNGGYSLG ARATQVRDRL FEKQKFVEDD FYQLQLDNQA       540
     RFLIPWHALL LKQLKADEGN NAAYISAVEN WQQCACASSV GYTLIKHYRD EVINITFSTL       600
     QQSLSEKNGT LSYVRRDLEP AVWQLINAQP SSWLNPQFST WEQQLQGAFS QTIAKLSTQY       660
     GNNIQGWQWG KVNELVIEHP FAKQIPILAR FLNMPKTPGF GDSYMPAVQG RSFGASQRFI       720
     VQPGHLENAI LTVPGGQSGH PLSNFYRAGF SQYINAENTP LLPQALVHQI IISPKGK          777
//

If you have problems or comments...

PBIL Back to PBIL home page