(data stored in ACNUC7421 zone)

EMBL: CR954246.PE75

CR954246.PE75        Location/Qualifiers
FT   CDS             86306..87157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0080"
FT                   /product="putative secreted hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85189"
FT                   /db_xref="GOA:Q3IDS0"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS0"
FT                   /protein_id="CAI85189.1"
FT                   /translation="MKKLLPALITGLLLSSAAYADESVVKTQKLSEHIYMLLGQGGNIA
FT                   VSVGDDGIYIIDDQFAKLSSDIKKTISDLQPGSTEFVINTHHHGDHTGGNENFAKAGAH
FT                   VIAHDNVHKRLVAEHGEGSDFLPRISFSHDLKLHFNNEHAHVMHYQHAHTDGDAVIFFN
FT                   KANIVHMGDIFFNFGSLPFVDVDSGGSVDGILAAVDDVVKQIDDNTKVIPGHGPLSDRS
FT                   GLVVYRKLVQKAKDVMLKAMQNKASLEQVLNADPLAELGLEYASWLPKERVTTLFYRSL
FT                   KQ"
     MKKLLPALIT GLLLSSAAYA DESVVKTQKL SEHIYMLLGQ GGNIAVSVGD DGIYIIDDQF        60
     AKLSSDIKKT ISDLQPGSTE FVINTHHHGD HTGGNENFAK AGAHVIAHDN VHKRLVAEHG       120
     EGSDFLPRIS FSHDLKLHFN NEHAHVMHYQ HAHTDGDAVI FFNKANIVHM GDIFFNFGSL       180
     PFVDVDSGGS VDGILAAVDD VVKQIDDNTK VIPGHGPLSD RSGLVVYRKL VQKAKDVMLK       240
     AMQNKASLEQ VLNADPLAEL GLEYASWLPK ERVTTLFYRS LKQ                         283
//

If you have problems or comments...

PBIL Back to PBIL home page