(data stored in ACNUC7421 zone)

EMBL: CR954246.PE76

CR954246.PE76        Location/Qualifiers
FT   CDS             87246..88817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0081"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85190"
FT                   /db_xref="GOA:Q3IDR9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR9"
FT                   /protein_id="CAI85190.1"
FT                   /translation="MTVEKTHLEICNLTKEQYPQIKTLMDQAYPDLGGAWPSHTIFRLI
FT                   DQFPEGQIGIVDDGVLVGLALSVQVDYARFSNPHTYEDIADGHDRVFSDTAGDALYGLD
FT                   VAISETHRGMRLGRRLYDARKELCRQYNLRAILAGGRIPRYYNHSNEMTPMEYIAKVDQ
FT                   KELYDPILSFQLANDFQVKRLLKKYLPEDQESVGYATLLEWNNILYEPTDTVINIVKSI
FT                   VRVGAVQWQMRKVESVEEMLKQVEYFVDTVSDYQSDFILFPEFFNAPLMGLTEQVNQTE
FT                   AIRNLAEYTETFKNAMSRMAIEYNANIITGSMPVADGDKIYNVSYLCHRSGKIDEQRKI
FT                   HITPHEQNDWVIQGGDKIAVFETDAGRVGIQICYDVEFPELSRIMAKEGLEILFVPFWT
FT                   DTKNSYLRVRHCAQARAIENECYVVIAGSVGNLPEVESLDVQFAQSAVLTPSDFSFPHD
FT                   ATLNEATTNTEMLLFSDLDMDKLKILHSEGTVRNLKDRREDLYDIMLKKVSDDKKVSAD
FT                   KQKSSF"
     MTVEKTHLEI CNLTKEQYPQ IKTLMDQAYP DLGGAWPSHT IFRLIDQFPE GQIGIVDDGV        60
     LVGLALSVQV DYARFSNPHT YEDIADGHDR VFSDTAGDAL YGLDVAISET HRGMRLGRRL       120
     YDARKELCRQ YNLRAILAGG RIPRYYNHSN EMTPMEYIAK VDQKELYDPI LSFQLANDFQ       180
     VKRLLKKYLP EDQESVGYAT LLEWNNILYE PTDTVINIVK SIVRVGAVQW QMRKVESVEE       240
     MLKQVEYFVD TVSDYQSDFI LFPEFFNAPL MGLTEQVNQT EAIRNLAEYT ETFKNAMSRM       300
     AIEYNANIIT GSMPVADGDK IYNVSYLCHR SGKIDEQRKI HITPHEQNDW VIQGGDKIAV       360
     FETDAGRVGI QICYDVEFPE LSRIMAKEGL EILFVPFWTD TKNSYLRVRH CAQARAIENE       420
     CYVVIAGSVG NLPEVESLDV QFAQSAVLTP SDFSFPHDAT LNEATTNTEM LLFSDLDMDK       480
     LKILHSEGTV RNLKDRREDL YDIMLKKVSD DKKVSADKQK SSF                         523
//

If you have problems or comments...

PBIL Back to PBIL home page