(data stored in ACNUC7421 zone)

EMBL: CR954246.PE78

CR954246.PE78        Location/Qualifiers
FT   CDS             complement(89331..90173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0083"
FT                   /product="conserved protein of unknown function ; putative
FT                   integral inner membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85192"
FT                   /db_xref="GOA:Q3IDR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR7"
FT                   /protein_id="CAI85192.1"
FT                   /translation="MQAWRNALQSKLSSNVSVAGVTLSRFIVAGPIAAVYLYGLYQYQD
FT                   TAMPSFNNAFWGFIIGASIMQILATGLMVKLFKMNNYAVGAGLAKSEALVAAILGVLFF
FT                   GSALTLLGWLGVFLGAIAVLLMSGITSIKRFDAKTALLGLACGTCFALTSLWVREGSLN
FT                   SGLLFPHSAAWVLLFVISLQTLILLGYLLLKEPHTLSKLWQYKGTTVAISIFSCVGSIG
FT                   WFSAMSLQHVAYVKTLGQIEVFFTILIAVLWLKQPLKKQDSAGLLLIAVAAILVMLPN"
     MQAWRNALQS KLSSNVSVAG VTLSRFIVAG PIAAVYLYGL YQYQDTAMPS FNNAFWGFII        60
     GASIMQILAT GLMVKLFKMN NYAVGAGLAK SEALVAAILG VLFFGSALTL LGWLGVFLGA       120
     IAVLLMSGIT SIKRFDAKTA LLGLACGTCF ALTSLWVREG SLNSGLLFPH SAAWVLLFVI       180
     SLQTLILLGY LLLKEPHTLS KLWQYKGTTV AISIFSCVGS IGWFSAMSLQ HVAYVKTLGQ       240
     IEVFFTILIA VLWLKQPLKK QDSAGLLLIA VAAILVMLPN                             280
//

If you have problems or comments...

PBIL Back to PBIL home page