(data stored in ACNUC7421 zone)

EMBL: CR954246.PE79

CR954246.PE79        Location/Qualifiers
FT   CDS             90432..90815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0084"
FT                   /product="putative membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85193"
FT                   /db_xref="GOA:Q3IDR6"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR6"
FT                   /protein_id="CAI85193.1"
FT                   /translation="MTILIACALLAIVMPYLARIPAVIELNKLGGYDNKHPRQQQTQLT
FT                   GLGARALAAHQNCFESLAVFAVALAVVLGTNNVNAVTETLAMSHIVARVLFCAFYYLNL
FT                   DIMRSIMWFVGISTAIAMIAVSF"
     MTILIACALL AIVMPYLARI PAVIELNKLG GYDNKHPRQQ QTQLTGLGAR ALAAHQNCFE        60
     SLAVFAVALA VVLGTNNVNA VTETLAMSHI VARVLFCAFY YLNLDIMRSI MWFVGISTAI       120
     AMIAVSF                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page