(data stored in ACNUC7421 zone)

EMBL: CR954246.PE8

CR954246.PE8         Location/Qualifiers
FT   CDS             9961..10914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0008"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85122"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ26"
FT                   /protein_id="CAI85122.1"
FT                   /translation="MNNYIEYCYLENDKPSYERIKLTESDLSECINKYRVFSRKLEIEN
FT                   LFDVLIEEFKTFKSLLTMAQLSQEFSHFSEVHAYIENQKARTKLNISYLSILNTGKLVL
FT                   DRLYNKRDNFSIINDIDQSLLPELLIERERIFKENQYYVLCCNLRNLCQHKMLPVNRLT
FT                   LKYPSKSTYGNGVITKFQIPLVLSAMEEAERIKLLRGLNSAFIDELLKSDLVDLNRAID
FT                   GYFEGIFDLMIKLRTLVNKSVTETEDYFSKLLDQNINLNMKRLLGPPALVVNNEKEFHL
FT                   DFEWFRVAHYLEEKNNLYFKSANLIRTQYIEAPSST"
     MNNYIEYCYL ENDKPSYERI KLTESDLSEC INKYRVFSRK LEIENLFDVL IEEFKTFKSL        60
     LTMAQLSQEF SHFSEVHAYI ENQKARTKLN ISYLSILNTG KLVLDRLYNK RDNFSIINDI       120
     DQSLLPELLI ERERIFKENQ YYVLCCNLRN LCQHKMLPVN RLTLKYPSKS TYGNGVITKF       180
     QIPLVLSAME EAERIKLLRG LNSAFIDELL KSDLVDLNRA IDGYFEGIFD LMIKLRTLVN       240
     KSVTETEDYF SKLLDQNINL NMKRLLGPPA LVVNNEKEFH LDFEWFRVAH YLEEKNNLYF       300
     KSANLIRTQY IEAPSST                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page