(data stored in ACNUC7421 zone)

EMBL: CR954246.PE80

CR954246.PE80        Location/Qualifiers
FT   CDS             complement(90852..91541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0085"
FT                   /product="putative ribosomal RNA pseudouridylate synthase"
FT                   /function="3.2.3.2 : rRNA modifications"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 11720289, 14659742, 14730022; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85194"
FT                   /db_xref="GOA:Q3IDR5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDR5"
FT                   /protein_id="CAI85194.1"
FT                   /translation="MSTKIRLAKYIAHAGVCSRKQASRLIDEGAVIVNNRPANHIDHVD
FT                   EQDQITVNGQIIKGTAELIYFAYHKPVGIDCKLDQNDPASLYHHLPTITRVYPIGRLDK
FT                   DSRGLLILTNDGELCNQLIHPDFHQPKRYLVSVNKSIDAEFCTKMAAGVPVDKQITLPC
FT                   SVEKIADKQFSIILKQGLNRQIRKMAHYCGYKVIDLYREQISELTLQTLNLAQGQYIAI
FT                   NKSDIIK"
     MSTKIRLAKY IAHAGVCSRK QASRLIDEGA VIVNNRPANH IDHVDEQDQI TVNGQIIKGT        60
     AELIYFAYHK PVGIDCKLDQ NDPASLYHHL PTITRVYPIG RLDKDSRGLL ILTNDGELCN       120
     QLIHPDFHQP KRYLVSVNKS IDAEFCTKMA AGVPVDKQIT LPCSVEKIAD KQFSIILKQG       180
     LNRQIRKMAH YCGYKVIDLY REQISELTLQ TLNLAQGQYI AINKSDIIK                   229
//

If you have problems or comments...

PBIL Back to PBIL home page