(data stored in ACNUC7421 zone)

EMBL: CR954246.PE83

CR954246.PE83        Location/Qualifiers
FT   CDS             complement(92146..92502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0088"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85197"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS4"
FT                   /protein_id="CAI85197.1"
FT                   /translation="MTLSDYLEKLANEPKSIEFTDTMAIIDTHYRFTPCAFNNHGLLSA
FT                   ASENNGSCKIFAFAKLNQLSKQNTLDCFGQFYHQDVLNNPKGSDHMNIRTFMLAPEVTP
FT                   FLGVTFTGEPLKAI"
     MTLSDYLEKL ANEPKSIEFT DTMAIIDTHY RFTPCAFNNH GLLSAASENN GSCKIFAFAK        60
     LNQLSKQNTL DCFGQFYHQD VLNNPKGSDH MNIRTFMLAP EVTPFLGVTF TGEPLKAI         118
//

If you have problems or comments...

PBIL Back to PBIL home page