(data stored in ACNUC7421 zone)

EMBL: CR954246.PE84

CR954246.PE84        Location/Qualifiers
FT   CDS             complement(92582..93286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0089"
FT                   /product="putative enzyme with a phosphatase-like domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85198"
FT                   /db_xref="GOA:Q3IDS3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS3"
FT                   /protein_id="CAI85198.1"
FT                   /translation="MIRFNRAIAPVSVLSFDLDDTLYDNRPIIKAAVQAQTDYLNTLPG
FT                   YQHQGLQQWLHCRDCALQQQPKLIEDVTQWRLQTLGLLLAKQGFNADDAKHFASAAYKV
FT                   FAQARSNITVTDDVLNLLDKLATRFTLIAITNGNADVSQFNLNNKFNLVLQAGLHGKAK
FT                   PHNNLFDQAATHLQVPHKAILHIGDSLDSDVQGANNAGCQSVWLNNQAANYTYKGLADI
FT                   EITNINALSHLI"
     MIRFNRAIAP VSVLSFDLDD TLYDNRPIIK AAVQAQTDYL NTLPGYQHQG LQQWLHCRDC        60
     ALQQQPKLIE DVTQWRLQTL GLLLAKQGFN ADDAKHFASA AYKVFAQARS NITVTDDVLN       120
     LLDKLATRFT LIAITNGNAD VSQFNLNNKF NLVLQAGLHG KAKPHNNLFD QAATHLQVPH       180
     KAILHIGDSL DSDVQGANNA GCQSVWLNNQ AANYTYKGLA DIEITNINAL SHLI             234
//

If you have problems or comments...

PBIL Back to PBIL home page