(data stored in ACNUC7421 zone)

EMBL: CR954246.PE86

CR954246.PE86        Location/Qualifiers
FT   CDS             complement(94242..94853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0091"
FT                   /product="conserved protein of unknown function conserved
FT                   in bacteria"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85200"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS1"
FT                   /protein_id="CAI85200.1"
FT                   /translation="MSELNAQQVVDYLQHHPDFLIQHPELLAQLELQQQAQGATSLVHI
FT                   QQRQLREHNTLLKNQIASMNKYAAQNEQVYRLFSLCHQQLCSNNDFDALASNLQDIICS
FT                   NPDISDCRLVKYDTKYAQLVEHRLSNSGHYLGRINQQERDLLFSDTAQSTAIYLIGDIN
FT                   KPIAILAFASNNANHFEPAQDTLFVLDFVVALQSRLLELA"
     MSELNAQQVV DYLQHHPDFL IQHPELLAQL ELQQQAQGAT SLVHIQQRQL REHNTLLKNQ        60
     IASMNKYAAQ NEQVYRLFSL CHQQLCSNND FDALASNLQD IICSNPDISD CRLVKYDTKY       120
     AQLVEHRLSN SGHYLGRINQ QERDLLFSDT AQSTAIYLIG DINKPIAILA FASNNANHFE       180
     PAQDTLFVLD FVVALQSRLL ELA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page