(data stored in ACNUC7421 zone)

EMBL: CR954246.PE89

CR954246.PE89        Location/Qualifiers
FT   CDS             complement(96998..97192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0094"
FT                   /product="putative small periplasmic lipoprotein"
FT                   /function="1.2 : Transport/binding proteins and
FT                   lipoproteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type s : structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85203"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEW1"
FT                   /protein_id="CAI85203.1"
FT                   /translation="MKAIHTSQFKQLLISTVLLSALAGCGQSGPLYLPEQKAEQNKPQD
FT                   VANPATQTEQTNTPKKQEQ"
     MKAIHTSQFK QLLISTVLLS ALAGCGQSGP LYLPEQKAEQ NKPQDVANPA TQTEQTNTPK        60
     KQEQ                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page