(data stored in ACNUC7421 zone)

EMBL: CR954246.PE91

CR954246.PE91        Location/Qualifiers
FT   CDS             97645..98316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0096"
FT                   /product="putative phospholipase/carboxylesterase family
FT                   protein"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85205"
FT                   /db_xref="GOA:Q3IEV9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEV9"
FT                   /protein_id="CAI85205.1"
FT                   /translation="MAIIVMSLEFVEYPAQGEHKATVIWLHGLGDSGEGFAPVAPQLQL
FT                   PNELGLRFIFPHAPVQPVTINGGMEMRSWYDIKSIELDKRADEQGVRDSAAKVEQLINQ
FT                   EIANGIAADKIILAGFSQGGVVALHLAPRFEQKLAGVMALSTYMCVPEKLADEALHTDL
FT                   NIFMAHGSQDNVVPPSAGKSAFEVLTALSMDVSWQEYPMAHQVCAEELQAIRHWLIARL
FT                   S"
     MAIIVMSLEF VEYPAQGEHK ATVIWLHGLG DSGEGFAPVA PQLQLPNELG LRFIFPHAPV        60
     QPVTINGGME MRSWYDIKSI ELDKRADEQG VRDSAAKVEQ LINQEIANGI AADKIILAGF       120
     SQGGVVALHL APRFEQKLAG VMALSTYMCV PEKLADEALH TDLNIFMAHG SQDNVVPPSA       180
     GKSAFEVLTA LSMDVSWQEY PMAHQVCAEE LQAIRHWLIA RLS                         223
//

If you have problems or comments...

PBIL Back to PBIL home page