(data stored in ACNUC7421 zone)

EMBL: CR954246.PE92

CR954246.PE92        Location/Qualifiers
FT   CDS             98339..99244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0097"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85206"
FT                   /db_xref="GOA:Q3IF66"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF66"
FT                   /protein_id="CAI85206.1"
FT                   /translation="MSQKIVIKANVKREPQESVTTLTYEWNWRRIVSISMLLLMTSAAV
FT                   IYGLTSAVSAEQDEHPNEPEDRVLAQSNDISQRAVTSLQTTQVELNTSATVASQNSESE
FT                   LLVAPINLVAEQKVAEPDKVAAAELPVIPQAEIKNNSPEPVNIEQVPTTDLLVDTDVAA
FT                   ISDTALSSTQGFAPLAQLASVALGAQIDTDKISRAVLTRKVSKREPVNVFAADIRLSQF
FT                   DETLSFFSELKNLQGQQVKHVWFFEDDIVAEIELDITSSRYRTYSTKNIMDSQIGQWRV
FT                   DVIDEQGQLIAQKEFRILAD"
     MSQKIVIKAN VKREPQESVT TLTYEWNWRR IVSISMLLLM TSAAVIYGLT SAVSAEQDEH        60
     PNEPEDRVLA QSNDISQRAV TSLQTTQVEL NTSATVASQN SESELLVAPI NLVAEQKVAE       120
     PDKVAAAELP VIPQAEIKNN SPEPVNIEQV PTTDLLVDTD VAAISDTALS STQGFAPLAQ       180
     LASVALGAQI DTDKISRAVL TRKVSKREPV NVFAADIRLS QFDETLSFFS ELKNLQGQQV       240
     KHVWFFEDDI VAEIELDITS SRYRTYSTKN IMDSQIGQWR VDVIDEQGQL IAQKEFRILA       300
     D                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page