(data stored in ACNUC7421 zone)

EMBL: CR954246.PE96

CR954246.PE96        Location/Qualifiers
FT   CDS             103222..105912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0101"
FT                   /product="putative sensor protein; similar to LuxQ in
FT                   Vibrio harveyi, similar to ArcB sensor in E. coli"
FT                   /function="1.3.1 : Sensors for chemicals"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85210"
FT                   /db_xref="GOA:Q3IF69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF69"
FT                   /protein_id="CAI85210.1"
FT                   /translation="MKGLFKLSFSLACAYFITGYFSNLLLAIDGFAVASWPPAGIAVAS
FT                   FLLWGRKSFLGIFVGALLTSLIHLDNVVDILNWQVFFQAAAIAIAVVFQAWLGAQIIIK
FT                   VIKAPLDLSSLKHSVQSLIIAGPVCCIIGASVGTSLLVFNNIIAQHAALDSFIAWWIGD
FT                   SIGVLIFTPLMLAAFNYSVMRYRLQVILPSLLIYILISVSFYGAASVKKEKNIQKQEIK
FT                   TLAVQDSITHKLDEISAHLALLATFFSSSEDVNFKEFRQFTAKQLSYSEEILAFEWVPY
FT                   VPKSALLEYQQMTQLADVEHFFVKEKSPTNQWQAVAERDVYYPIRYAYPLKGNEDAIGF
FT                   DLASNDFMQEALNKSKTLNEMVISQPVKLVQNQAELGVLFLHPVFGSMETEDDFKGFAV
FT                   AVVSLKKLSQSLLFDHENLVTASFLDINNTNNTHAIYIANNESMDLLKSYQLLIGNRMW
FT                   QVELHEPLVTTSWLIYWLAQIVGMLFVWLLVAFLISVTGTNVQIREQVARQTRTLRQEK
FT                   QKADEASQIKSQFLANMSHEVRTPINGIKGLHYLALQQNDWQQARTYIEQADGALGVLL
FT                   RVLNDLLDFSKMEAGKLDLMQEPVDIGRLAEEVINLIQFEVSVKSLEIKLDYDKNTNLM
FT                   INTDAIRLKQVLLNLLNNAVKFTAQGSITLKIWQSKTMTYLSVSDTGIGISKEAQKKLF
FT                   RPFAQADNSTSRQYGGTGLGLSICKKLVELMGGAIDLKSTAGQGSTFTFSLPLNSPLPK
FT                   VEKSEQSFSDVDIENVSFANSAVLLVEDNPLNQHVATAILKTKGCVADIANDGFAAIEM
FT                   LTEKSYDIVLMDIQMPKMDGLQATKVIRNELGLLDLPIIGLSANAHDDDVKKALACGMN
FT                   SYITKPIDANILFKALWHYLAAIEK"
     MKGLFKLSFS LACAYFITGY FSNLLLAIDG FAVASWPPAG IAVASFLLWG RKSFLGIFVG        60
     ALLTSLIHLD NVVDILNWQV FFQAAAIAIA VVFQAWLGAQ IIIKVIKAPL DLSSLKHSVQ       120
     SLIIAGPVCC IIGASVGTSL LVFNNIIAQH AALDSFIAWW IGDSIGVLIF TPLMLAAFNY       180
     SVMRYRLQVI LPSLLIYILI SVSFYGAASV KKEKNIQKQE IKTLAVQDSI THKLDEISAH       240
     LALLATFFSS SEDVNFKEFR QFTAKQLSYS EEILAFEWVP YVPKSALLEY QQMTQLADVE       300
     HFFVKEKSPT NQWQAVAERD VYYPIRYAYP LKGNEDAIGF DLASNDFMQE ALNKSKTLNE       360
     MVISQPVKLV QNQAELGVLF LHPVFGSMET EDDFKGFAVA VVSLKKLSQS LLFDHENLVT       420
     ASFLDINNTN NTHAIYIANN ESMDLLKSYQ LLIGNRMWQV ELHEPLVTTS WLIYWLAQIV       480
     GMLFVWLLVA FLISVTGTNV QIREQVARQT RTLRQEKQKA DEASQIKSQF LANMSHEVRT       540
     PINGIKGLHY LALQQNDWQQ ARTYIEQADG ALGVLLRVLN DLLDFSKMEA GKLDLMQEPV       600
     DIGRLAEEVI NLIQFEVSVK SLEIKLDYDK NTNLMINTDA IRLKQVLLNL LNNAVKFTAQ       660
     GSITLKIWQS KTMTYLSVSD TGIGISKEAQ KKLFRPFAQA DNSTSRQYGG TGLGLSICKK       720
     LVELMGGAID LKSTAGQGST FTFSLPLNSP LPKVEKSEQS FSDVDIENVS FANSAVLLVE       780
     DNPLNQHVAT AILKTKGCVA DIANDGFAAI EMLTEKSYDI VLMDIQMPKM DGLQATKVIR       840
     NELGLLDLPI IGLSANAHDD DVKKALACGM NSYITKPIDA NILFKALWHY LAAIEK           896
//

If you have problems or comments...

PBIL Back to PBIL home page