(data stored in ACNUC7421 zone)

EMBL: CR954246.PE98

CR954246.PE98        Location/Qualifiers
FT   CDS             complement(107138..107548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0103"
FT                   /product="conserved protein of unknown function ; could be
FT                   a dehydrogenase; putative inosine binding site"
FT                   /function="5 : Similar to unknown proteins"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85212"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF67"
FT                   /protein_id="CAI85212.1"
FT                   /translation="MLNTKVKDFMQHKLPNITPDTEMTTAIAELQKFKLLGAPVFDSNK
FT                   FLVGFISEQELLKPLMQSSYFCDGVVKVSQLMQTEVVTVNGDTNIIELAEQMRPGKPKN
FT                   YPVVDGEKVIGMISRADILKALYDNYLACQTH"
     MLNTKVKDFM QHKLPNITPD TEMTTAIAEL QKFKLLGAPV FDSNKFLVGF ISEQELLKPL        60
     MQSSYFCDGV VKVSQLMQTE VVTVNGDTNI IELAEQMRPG KPKNYPVVDG EKVIGMISRA       120
     DILKALYDNY LACQTH                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page