(data stored in ACNUC7421 zone)

EMBL: CR954246.PEPP

CR954246.PEPP        Location/Qualifiers
FT   CDS             582543..583865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="PSHAa0562"
FT                   /product="proline aminopeptidase P II"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2659585, 2851590; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0562"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85649"
FT                   /db_xref="GOA:Q3ILI4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILI4"
FT                   /protein_id="CAI85649.1"
FT                   /translation="MVEIQKSEFKARRERLLAKMDSNSVAIIPAASEVTRSRDTHYAFR
FT                   QDSDFFYLTGFNEPDAVLVLAPNSDTPSTLFCLNKDKLAEVWHGRRIGFEKAKNEYLFD
FT                   ATHELSELSEQLFNLLNGKAVLYYAQGAYSAFDGRVFSLLNTLRSAPKKGDTAPSTIKD
FT                   IRLLIHEMRLFKSPSEINIMRAGCEISAQGHVRAMCFAHSGATEYQLEAELHHHYAMHG
FT                   ARHPAYGTIVGSGDNANILHYTQNSDALKSGDLVLIDSGCELQGYAADITRTFPVNGKF
FT                   SPEQAALYNIVLKAQEVAFAEIKPGGYMSHANALAMAVMTQGLLDLGILTGDFNELMAK
FT                   QACKEYYMHGLGHWLGLDVHDVGDYKQNNSERAFAAGMVLTIEPGLYISEDSNAPQKYR
FT                   GIGIRIEDNLLVTPSGYENLTLSAPKTISDIEALMQSNKSA"
     MVEIQKSEFK ARRERLLAKM DSNSVAIIPA ASEVTRSRDT HYAFRQDSDF FYLTGFNEPD        60
     AVLVLAPNSD TPSTLFCLNK DKLAEVWHGR RIGFEKAKNE YLFDATHELS ELSEQLFNLL       120
     NGKAVLYYAQ GAYSAFDGRV FSLLNTLRSA PKKGDTAPST IKDIRLLIHE MRLFKSPSEI       180
     NIMRAGCEIS AQGHVRAMCF AHSGATEYQL EAELHHHYAM HGARHPAYGT IVGSGDNANI       240
     LHYTQNSDAL KSGDLVLIDS GCELQGYAAD ITRTFPVNGK FSPEQAALYN IVLKAQEVAF       300
     AEIKPGGYMS HANALAMAVM TQGLLDLGIL TGDFNELMAK QACKEYYMHG LGHWLGLDVH       360
     DVGDYKQNNS ERAFAAGMVL TIEPGLYISE DSNAPQKYRG IGIRIEDNLL VTPSGYENLT       420
     LSAPKTISDI EALMQSNKSA                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page