(data stored in ACNUC7421 zone)

EMBL: CR954246.PEPQ

CR954246.PEPQ        Location/Qualifiers
FT   CDS             17005..18327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepQ"
FT                   /locus_tag="PSHAa0013"
FT                   /product="Xaa-Pro proline dipeptidase"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.13.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6336737, 372108; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85127"
FT                   /db_xref="GOA:Q3IJ21"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ21"
FT                   /protein_id="CAI85127.1"
FT                   /translation="MDKLAVLYAEHIATLQQRTRTICEREGLEGLVIHSGQAKRQFLDD
FT                   MYYPFKVNPHFKAWLPVLDNPHCWIVVNGSDKPKLIFYRPVDFWHKVPDEPRDFWAEYF
FT                   DIELLLQPDQVEKLLPYDKANYAYVGEYLEVAQALGFSVMNPEPVLNYFHYHRAYKTQY
FT                   ELECLRNANRIAVDGHKAARDTFFNGGSEFDIQQAYLMATRQSENEMPYGNIVALNENC
FT                   AILHYTHFEAKAPQQHNSFLIDAGANFNGYAADITRTYDFKKQGEFAELVQAMTAAQIE
FT                   LGTGLKPGMLYGDLHVECHNRVAQILSDFDIVKLPAEEIVERKITSTFFPHGLGHHLGL
FT                   QVHDMGGFMADEMGAQQAAPEGHPFLRCTRIIEKNQVFTIEPGLYFIDSLLGDLAQTDN
FT                   KQFINWQKVESFKPYGGIRIEDNIIVHEDSLENMTRNLALD"
     MDKLAVLYAE HIATLQQRTR TICEREGLEG LVIHSGQAKR QFLDDMYYPF KVNPHFKAWL        60
     PVLDNPHCWI VVNGSDKPKL IFYRPVDFWH KVPDEPRDFW AEYFDIELLL QPDQVEKLLP       120
     YDKANYAYVG EYLEVAQALG FSVMNPEPVL NYFHYHRAYK TQYELECLRN ANRIAVDGHK       180
     AARDTFFNGG SEFDIQQAYL MATRQSENEM PYGNIVALNE NCAILHYTHF EAKAPQQHNS       240
     FLIDAGANFN GYAADITRTY DFKKQGEFAE LVQAMTAAQI ELGTGLKPGM LYGDLHVECH       300
     NRVAQILSDF DIVKLPAEEI VERKITSTFF PHGLGHHLGL QVHDMGGFMA DEMGAQQAAP       360
     EGHPFLRCTR IIEKNQVFTI EPGLYFIDSL LGDLAQTDNK QFINWQKVES FKPYGGIRIE       420
     DNIIVHEDSL ENMTRNLALD                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page