(data stored in ACNUC7421 zone)

EMBL: CR954246.PILB

CR954246.PILB        Location/Qualifiers
FT   CDS             complement(393375..395048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="PSHAa0378"
FT                   /product="type IV pilus biogenesis protein PilB"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85476"
FT                   /db_xref="GOA:Q3IID2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID2"
FT                   /protein_id="CAI85476.1"
FT                   /translation="MNINSPLLRKFITLGRVDADIVKTKQQEFASTAELIAKCGKIDSK
FT                   DLAAQCIDLFRVPFFDLKDFNTALISPELIKEKLIRKHHILPLVQKGRKVYIAASDPTD
FT                   YGAFENFEFSTGLSCEVVVVDYIQLDKKIEQLLDATGSLNLSDDEFKEFAELDADIQKD
FT                   TTKDDDKDDAPIIVYINKILMDAIKKGASDLHFEPYEHKYRIRFRIDGILHEVASPPNS
FT                   LATKLSARIKVMSRLDIAEKRKPQDGRIKLKITERKSVDFRVSTMPTLWGEKIVMRILD
FT                   SSSAMLGIDVLGYEPEQKKLYMDALEQPQGMILVTGPTGSGKTVSLYTGLNILNQPERN
FT                   ISTAEDPVEINLEGVNQVQINIKADMTFANALRAFLRQDPDVVMVGEIRDLETAEISIK
FT                   AAQTGHLVLSTLHTNSAPETITRLLNMGVPAYNVASSISLIIAQRLARRLCPKCKTPEN
FT                   LPSEELLRQGFSQQQISEMTLYAPKGCENCTDGYKGRVGIYEVMKITPEIAQIIMRGGN
FT                   SLEIAEVSLKAGFNNLRLSGIRKAADGMTSLAEINRVTSF"
     MNINSPLLRK FITLGRVDAD IVKTKQQEFA STAELIAKCG KIDSKDLAAQ CIDLFRVPFF        60
     DLKDFNTALI SPELIKEKLI RKHHILPLVQ KGRKVYIAAS DPTDYGAFEN FEFSTGLSCE       120
     VVVVDYIQLD KKIEQLLDAT GSLNLSDDEF KEFAELDADI QKDTTKDDDK DDAPIIVYIN       180
     KILMDAIKKG ASDLHFEPYE HKYRIRFRID GILHEVASPP NSLATKLSAR IKVMSRLDIA       240
     EKRKPQDGRI KLKITERKSV DFRVSTMPTL WGEKIVMRIL DSSSAMLGID VLGYEPEQKK       300
     LYMDALEQPQ GMILVTGPTG SGKTVSLYTG LNILNQPERN ISTAEDPVEI NLEGVNQVQI       360
     NIKADMTFAN ALRAFLRQDP DVVMVGEIRD LETAEISIKA AQTGHLVLST LHTNSAPETI       420
     TRLLNMGVPA YNVASSISLI IAQRLARRLC PKCKTPENLP SEELLRQGFS QQQISEMTLY       480
     APKGCENCTD GYKGRVGIYE VMKITPEIAQ IIMRGGNSLE IAEVSLKAGF NNLRLSGIRK       540
     AADGMTSLAE INRVTSF                                                      557
//

If you have problems or comments...

PBIL Back to PBIL home page