(data stored in ACNUC7421 zone)

EMBL: CR954246.PILC

CR954246.PILC        Location/Qualifiers
FT   CDS             complement(396727..397953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="PSHAa0381"
FT                   /product="type IV pilus biogenesis protein PilC"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85479"
FT                   /db_xref="GOA:Q3IIC9"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC9"
FT                   /protein_id="CAI85479.1"
FT                   /translation="MAKQQEKKGQDTFEWVGVSTRGKRLEGELTGSSVALVKAQLRKQG
FT                   ITPSKVKRKAKPLFGARLQKITPKDIAIVTRQIATMLMAGVPLIQSIEMIGTGATNKSL
FT                   GKLMETIADEVKAGQPLSQALRRHPRYFDDLYCDLVASGEQSGALDKIFDRVAIYKEKS
FT                   EALKSKIKKAMFYPIAVLVIALIVTSILLIFVVPQFQDIFAGFGAELPAFTLFVISISE
FT                   FMQAYWWIILIIMFAFGWAFKEAHLKSLKLRDATDRAILKLPVIGMILNKAAVARYART
FT                   LSTTFAAGVPLVDALDSAAGASGNAVYRYAILEIKAEVSSGNQMNWAMRNSKIFPDMVI
FT                   QMVAIGEESGSLDGMLGKVATIYEQEVDDAVDGLSSLLEPMIMAVLGVLVGGLIIAMYL
FT                   PIFQLGSVI"
     MAKQQEKKGQ DTFEWVGVST RGKRLEGELT GSSVALVKAQ LRKQGITPSK VKRKAKPLFG        60
     ARLQKITPKD IAIVTRQIAT MLMAGVPLIQ SIEMIGTGAT NKSLGKLMET IADEVKAGQP       120
     LSQALRRHPR YFDDLYCDLV ASGEQSGALD KIFDRVAIYK EKSEALKSKI KKAMFYPIAV       180
     LVIALIVTSI LLIFVVPQFQ DIFAGFGAEL PAFTLFVISI SEFMQAYWWI ILIIMFAFGW       240
     AFKEAHLKSL KLRDATDRAI LKLPVIGMIL NKAAVARYAR TLSTTFAAGV PLVDALDSAA       300
     GASGNAVYRY AILEIKAEVS SGNQMNWAMR NSKIFPDMVI QMVAIGEESG SLDGMLGKVA       360
     TIYEQEVDDA VDGLSSLLEP MIMAVLGVLV GGLIIAMYLP IFQLGSVI                    408
//

If you have problems or comments...

PBIL Back to PBIL home page