(data stored in ACNUC7421 zone)

EMBL: CR954246.PILD

CR954246.PILD        Location/Qualifiers
FT   CDS             complement(395803..396678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="PSHAa0380"
FT                   /product="Type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /function="3.3.6 : Protein modifications"
FT                   /EC_number="3.4.23.43"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1971619, 9224881; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85478"
FT                   /db_xref="GOA:Q3IID0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID0"
FT                   /protein_id="CAI85478.1"
FT                   /translation="MQSQLWFYLTTIGLVSLCVGSFLNVVIYRLPLMMQHEWQGECRLL
FT                   LESELKGNKADESESLNSTFNLVKPNSTCPKCKTAIKAWQNIPVVSWLFLKGKCASCSN
FT                   PISARYPIVEAITALLSLVVAYKLGATEQALLYIAITWALVALTFIDIDHMLLPDQITL
FT                   PLVWLALIAAVLGYTVTPTDAIIGAACGYLSLWSVFWLFKLLTGKEGMGYGDFKLLAVF
FT                   GALLGWQSLLTIILLSSVVGAIIGIALLTIQGKDKATPIPFGPYLAIAGWITMLWGEQL
FT                   QTSYFNLIGY"
     MQSQLWFYLT TIGLVSLCVG SFLNVVIYRL PLMMQHEWQG ECRLLLESEL KGNKADESES        60
     LNSTFNLVKP NSTCPKCKTA IKAWQNIPVV SWLFLKGKCA SCSNPISARY PIVEAITALL       120
     SLVVAYKLGA TEQALLYIAI TWALVALTFI DIDHMLLPDQ ITLPLVWLAL IAAVLGYTVT       180
     PTDAIIGAAC GYLSLWSVFW LFKLLTGKEG MGYGDFKLLA VFGALLGWQS LLTIILLSSV       240
     VGAIIGIALL TIQGKDKATP IPFGPYLAIA GWITMLWGEQ LQTSYFNLIG Y                291
//

If you have problems or comments...

PBIL Back to PBIL home page