(data stored in ACNUC7421 zone)

EMBL: CR954246.PLDA

CR954246.PLDA        Location/Qualifiers
FT   CDS             complement(183849..184883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pldA"
FT                   /locus_tag="PSHAa0175"
FT                   /product="putative outer membrane phospholipase A
FT                   precursor"
FT                   /function="1.1.2 : Biosynthesis and degradation of surface
FT                   polysaccarides and lipopolysaccharides"
FT                   /EC_number="3.1.1.32"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85278"
FT                   /db_xref="GOA:Q3IJ39"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ39"
FT                   /protein_id="CAI85278.1"
FT                   /translation="MSWRYLIILSTLVSTTVFAEEKPKNNEQNSNIELVKQCILNEVIG
FT                   GDGKQTLDQLRKKCSALEEDKQLTAIDKRKAREAVSQKNRNVITPHKRNYILPISYVSH
FT                   PNNSSFETFDELTGEKNDEPLDNLEAKYQLSIKVPLFNDFSDKDQAIFFAFTLQSYWQL
FT                   YNKESSSPFRETNYEPEVFWVNYLDPEHVPWGDEMAVVLGISHQSNGNSQPNSRSWNRI
FT                   YANFIWEKNGFVFNFKPWYRISESEKETPLDPRGDDNPDIYKYMGYFEFSGAYRLNEHE
FT                   FSFMTRNNLNSDNRGALQLDWSFPLWGRVRGYAQYFNGYGESLIDYNADIERIGVGILL
FT                   TDLL"
     MSWRYLIILS TLVSTTVFAE EKPKNNEQNS NIELVKQCIL NEVIGGDGKQ TLDQLRKKCS        60
     ALEEDKQLTA IDKRKAREAV SQKNRNVITP HKRNYILPIS YVSHPNNSSF ETFDELTGEK       120
     NDEPLDNLEA KYQLSIKVPL FNDFSDKDQA IFFAFTLQSY WQLYNKESSS PFRETNYEPE       180
     VFWVNYLDPE HVPWGDEMAV VLGISHQSNG NSQPNSRSWN RIYANFIWEK NGFVFNFKPW       240
     YRISESEKET PLDPRGDDNP DIYKYMGYFE FSGAYRLNEH EFSFMTRNNL NSDNRGALQL       300
     DWSFPLWGRV RGYAQYFNGY GESLIDYNAD IERIGVGILL TDLL                        344
//

If you have problems or comments...

PBIL Back to PBIL home page