(data stored in ACNUC7421 zone)

EMBL: CR954246.PLSB

CR954246.PLSB        Location/Qualifiers
FT   CDS             complement(153368..155806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="PSHAa0142"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="2.3.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7929384, 10231527; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85246"
FT                   /db_xref="GOA:Q3IF27"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF27"
FT                   /protein_id="CAI85246.1"
FT                   /translation="MRIVNYCLNVLSAGVSRLLVRSKVLPEKPTEQYELNSKNPTFYIV
FT                   RLNSRFDLAALARVCKRHGLPDPREQQVLGTQRLDRFIGIENPPPLIGDIAKPTNALAQ
FT                   GKQIIDHLLSSGQKDVQVIPVTILWGRAPGKEKPGLSTLITHSLTPSWFRKLFVVLFSG
FT                   RDNFIRFSQPLDLSLLVDEKADVNELPQKLLRVARVHFRRQKLAATGPKMPSREQLFNS
FT                   LLASPTIKKAIQDEAKAKNISQAQARQNAVKLLNEIAANYSEAMIRVAERFLTWLWNKL
FT                   YNGIDIKYTEQIHELTNKGHEIIYMPCHRSHMDYLLLTYAIYHQGLVPPHIAAGINLNF
FT                   FPAGGIFRRSGAFFIRRSFAGNKLYSAVFKEYLSQLFIKGYSVKFYTEGGRSRTGRLLP
FT                   PKTGMLAMTMQAMLRGIDRPISIVPVYIGYEHVMEINTYLKELAGNDKKGESIFGIFKA
FT                   IKNLKNYGRGYLNFGDPISINQYLNDNQPNWRDDIHPTDVQKPQWLGPQVANLADQVMV
FT                   KINNAAALNAVNLLAMILLVNDKHALSKPKLLAQLDFYLRLQRDASYSNKVTAPEETPE
FT                   QLLTHALKLNKFDVISDEFGEIIAINDKEKTLFNYYRNNILHLFAVPSLIALHLFREKT
FT                   TTVSKCQQLVAAFYPLFAKEWYLRELDEDYITRILANFVDQNLIELDGDNIHITNTNDC
FT                   LAKLDMLGKALNFTLQRYAIVIGFIQTSNGIEKAELERESQVLAQRLGTLHGIKTPEFF
FT                   DKKVLVSFIDNLRAQSLITDGDAGLIGSVQLCETYMHLKALLPARVWQSISDIVQGQCK
FT                   "
     MRIVNYCLNV LSAGVSRLLV RSKVLPEKPT EQYELNSKNP TFYIVRLNSR FDLAALARVC        60
     KRHGLPDPRE QQVLGTQRLD RFIGIENPPP LIGDIAKPTN ALAQGKQIID HLLSSGQKDV       120
     QVIPVTILWG RAPGKEKPGL STLITHSLTP SWFRKLFVVL FSGRDNFIRF SQPLDLSLLV       180
     DEKADVNELP QKLLRVARVH FRRQKLAATG PKMPSREQLF NSLLASPTIK KAIQDEAKAK       240
     NISQAQARQN AVKLLNEIAA NYSEAMIRVA ERFLTWLWNK LYNGIDIKYT EQIHELTNKG       300
     HEIIYMPCHR SHMDYLLLTY AIYHQGLVPP HIAAGINLNF FPAGGIFRRS GAFFIRRSFA       360
     GNKLYSAVFK EYLSQLFIKG YSVKFYTEGG RSRTGRLLPP KTGMLAMTMQ AMLRGIDRPI       420
     SIVPVYIGYE HVMEINTYLK ELAGNDKKGE SIFGIFKAIK NLKNYGRGYL NFGDPISINQ       480
     YLNDNQPNWR DDIHPTDVQK PQWLGPQVAN LADQVMVKIN NAAALNAVNL LAMILLVNDK       540
     HALSKPKLLA QLDFYLRLQR DASYSNKVTA PEETPEQLLT HALKLNKFDV ISDEFGEIIA       600
     INDKEKTLFN YYRNNILHLF AVPSLIALHL FREKTTTVSK CQQLVAAFYP LFAKEWYLRE       660
     LDEDYITRIL ANFVDQNLIE LDGDNIHITN TNDCLAKLDM LGKALNFTLQ RYAIVIGFIQ       720
     TSNGIEKAEL ERESQVLAQR LGTLHGIKTP EFFDKKVLVS FIDNLRAQSL ITDGDAGLIG       780
     SVQLCETYMH LKALLPARVW QSISDIVQGQ CK                                     812
//

If you have problems or comments...

PBIL Back to PBIL home page