(data stored in ACNUC7421 zone)

EMBL: CR954246.PORA

CR954246.PORA        Location/Qualifiers
FT   CDS             260899..261537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="porA"
FT                   /locus_tag="PSHAa0249"
FT                   /product="periplasmic protein, disulfide bond formation"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85352"
FT                   /db_xref="GOA:Q3ILM3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM3"
FT                   /protein_id="CAI85352.1"
FT                   /translation="MIKLVKAGLLAVLLPFAATSFAATFEEGVHYEVVSERATKKPEVK
FT                   EFFSFYCPACNNMEPLVAEIKPMLDKGVKFKKSHVDFVGVRDTEHQQMISQALATAEVL
FT                   PQKDKIIAAIFSHIHTKRANFNELADVKDVFVAQGVDGDKFDKLFKSFSVRTLSSKMKR
FT                   DQDYFKEKGALRGVPTFIVNGKYKLLLGRESGISEPADITKLINYLASK"
     MIKLVKAGLL AVLLPFAATS FAATFEEGVH YEVVSERATK KPEVKEFFSF YCPACNNMEP        60
     LVAEIKPMLD KGVKFKKSHV DFVGVRDTEH QQMISQALAT AEVLPQKDKI IAAIFSHIHT       120
     KRANFNELAD VKDVFVAQGV DGDKFDKLFK SFSVRTLSSK MKRDQDYFKE KGALRGVPTF       180
     IVNGKYKLLL GRESGISEPA DITKLINYLA SK                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page