(data stored in ACNUC7421 zone)

EMBL: CR954246.PPA

CR954246.PPA         Location/Qualifiers
FT   CDS             complement(465647..466573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="PSHAa0445"
FT                   /product="inorganic pyrophosphatase, manganese-dependent"
FT                   /EC_number="3.6.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85542"
FT                   /db_xref="GOA:Q3IEI4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IEI4"
FT                   /protein_id="CAI85542.1"
FT                   /translation="MSMYVVGHKIPDSDSICGAIALAYLKNQINEPAIPTRLGEISPET
FT                   QFILDKFGFEAPELKLSYAGEDVYIVDHTEKTQAPDDIDQARIVGVVDHHKLGDLTSSA
FT                   PLECWIRPVGCSNTIIKMMYDFYNVEIPKNIAGIMMCAILSDTVIFKSPTCTTADIKCV
FT                   EALAEIAGIDDPKELGMEMFRVKSAVADTPIRDLVMRDFKDFNMNGNLVGIGQLEVIDL
FT                   AVFDDIKADLATDIAKLKTEGNRHSVFLLLTDIMKEGSEMLIASDDANLVEQAYGEKPA
FT                   DGKVWLDGVLSRKKQVVPPLQDAFQKV"
     MSMYVVGHKI PDSDSICGAI ALAYLKNQIN EPAIPTRLGE ISPETQFILD KFGFEAPELK        60
     LSYAGEDVYI VDHTEKTQAP DDIDQARIVG VVDHHKLGDL TSSAPLECWI RPVGCSNTII       120
     KMMYDFYNVE IPKNIAGIMM CAILSDTVIF KSPTCTTADI KCVEALAEIA GIDDPKELGM       180
     EMFRVKSAVA DTPIRDLVMR DFKDFNMNGN LVGIGQLEVI DLAVFDDIKA DLATDIAKLK       240
     TEGNRHSVFL LLTDIMKEGS EMLIASDDAN LVEQAYGEKP ADGKVWLDGV LSRKKQVVPP       300
     LQDAFQKV                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page