(data stored in ACNUC7421 zone)

EMBL: CR954246.PPDD

CR954246.PPDD        Location/Qualifiers
FT   CDS             complement(399118..399549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="PSHAa0384"
FT                   /product="putative prepilin peptidase dependent protein D"
FT                   /function="1.9 : Collective behaviour"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7959070, 10633126, 10811613; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85482"
FT                   /db_xref="GOA:Q3IIC6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC6"
FT                   /protein_id="CAI85482.1"
FT                   /translation="MKTMTQQNQKGFTLIELMIVIAIIGILAAIALPQYQTYTKKARFS
FT                   EVVLAASSAKGLIDVCFQTRGAGSLANCDTDKKIGLTAGVADGAHVASVVIKPTDAEIT
FT                   ATGESTVDGATYILTPTVSTNAGTLTWAQTGDCVEKGVC"
     MKTMTQQNQK GFTLIELMIV IAIIGILAAI ALPQYQTYTK KARFSEVVLA ASSAKGLIDV        60
     CFQTRGAGSL ANCDTDKKIG LTAGVADGAH VASVVIKPTD AEITATGEST VDGATYILTP       120
     TVSTNAGTLT WAQTGDCVEK GVC                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page