(data stored in ACNUC7421 zone)

EMBL: CR954246.PRFB

CR954246.PRFB        Location/Qualifiers
FT   CDS             join(531558..531632,531634..532656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="PSHAa0517"
FT                   /product="peptide chain release factor 2 (RF-2)"
FT                   /function="3.3.5 : Termination"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3889910, 11118225, 2456575; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85607"
FT                   /db_xref="GOA:Q3ILD8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILD8"
FT                   /protein_id="CAI85607.1"
FT                   /translation="MFEVNPVINQIKEIRERTELLRGYLDYALKQERLEEVNAELEDSA
FT                   VWNEPERAQALGREKSALEAVVETIDTLVTGTDDVEGLLELAVEAEDQETFDEAQSELA
FT                   DLNEQLEALEFRRMFSGPHDSNDAYLDLQSGSGGTEAQDWCNILLRMYLRWGEAKGFKV
FT                   ELVEATGGDVAGIKGATVRFVGEYAYGWLRTETGVHRLVRKSPFDSSGRRHTSFASAFV
FT                   YPEVDDNIEIDMNPSDLRIDVYRASGAGGQHVNTTESAVRITHVPTNTVVQCQNERSQH
FT                   KNKAQAMKQLKAKLFELELQQQNAEKQTQEDSKSDIGWGSQIRSYVLDDARIKDLRTGV
FT                   ESRNTQSVLDGNLDKFIEASLKSGL"
     MFEVNPVINQ IKEIRERTEL LRGYLDYALK QERLEEVNAE LEDSAVWNEP ERAQALGREK        60
     SALEAVVETI DTLVTGTDDV EGLLELAVEA EDQETFDEAQ SELADLNEQL EALEFRRMFS       120
     GPHDSNDAYL DLQSGSGGTE AQDWCNILLR MYLRWGEAKG FKVELVEATG GDVAGIKGAT       180
     VRFVGEYAYG WLRTETGVHR LVRKSPFDSS GRRHTSFASA FVYPEVDDNI EIDMNPSDLR       240
     IDVYRASGAG GQHVNTTESA VRITHVPTNT VVQCQNERSQ HKNKAQAMKQ LKAKLFELEL       300
     QQQNAEKQTQ EDSKSDIGWG SQIRSYVLDD ARIKDLRTGV ESRNTQSVLD GNLDKFIEAS       360
     LKSGL                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page