(data stored in ACNUC7421 zone)

EMBL: CR954246.PRLC

CR954246.PRLC        Location/Qualifiers
FT   CDS             375903..377954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="PSHAa0361"
FT                   /product="oligopeptidase A"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.24.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1325967, 8366062, 1537805; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0361"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85459"
FT                   /db_xref="GOA:Q3IIA7"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIA7"
FT                   /protein_id="CAI85459.1"
FT                   /translation="MTNANTNPLIGLEGLPPFSKIKPEHVVPALKHGIEQCRQAIEDVL
FT                   AKKSYTWNDLVLPLEEADDKLSRMFSPVSHLNSVMNNDELREQYEQCLPLISEYSTFVG
FT                   QHQGLFAAYNALYNSDEFKTLTTAQQKSITNALRDFKLSGIALEPAQQKRYGEISARLS
FT                   ELASKFGNNVMDATLAWHKHITDESELAGLPESALALAADTAKSKELDGWVFTLDFPSY
FT                   LPIMTYADNRELREETYTAFSTRASDQGPNAGEFDNSAIMSEELALRHELAQLLGFNSY
FT                   AEKSLATKMAETPAQVFSFLEDLAAKSKPQAEQELAELQAYAEQKHGITELAAWDFGYY
FT                   GEKLKQDKYAISDEVLRPYFPANKVLSGLFETVNRLFGISVKEVSDFDSYHKDVRFFEI
FT                   YDSSNTLRGRFYLDLYARDHKRGGAWMDDCMGRKVRASGELQTPVAYLVCNFNKAIGDK
FT                   PALFTHNEVTTLFHEFGHGIHHMLTQVDAAPVAGINGVAWDAVELPSQFLENWCYEEQA
FT                   LSFISGHYETGEPLPKELLDKLLAAKNYNSGMQMLRQLEFSLFDFKIHNDYVAGEPCNI
FT                   QAVLNDVRSRTSVIKAPEFNRFQHGFSHIFAGGYSAGYYSYKWAEVLSADAYSKFEEEG
FT                   IFNPETGRAFMQHILEKGGSEEPMELFKNFRGREPNVDALLRHSGIAA"
     MTNANTNPLI GLEGLPPFSK IKPEHVVPAL KHGIEQCRQA IEDVLAKKSY TWNDLVLPLE        60
     EADDKLSRMF SPVSHLNSVM NNDELREQYE QCLPLISEYS TFVGQHQGLF AAYNALYNSD       120
     EFKTLTTAQQ KSITNALRDF KLSGIALEPA QQKRYGEISA RLSELASKFG NNVMDATLAW       180
     HKHITDESEL AGLPESALAL AADTAKSKEL DGWVFTLDFP SYLPIMTYAD NRELREETYT       240
     AFSTRASDQG PNAGEFDNSA IMSEELALRH ELAQLLGFNS YAEKSLATKM AETPAQVFSF       300
     LEDLAAKSKP QAEQELAELQ AYAEQKHGIT ELAAWDFGYY GEKLKQDKYA ISDEVLRPYF       360
     PANKVLSGLF ETVNRLFGIS VKEVSDFDSY HKDVRFFEIY DSSNTLRGRF YLDLYARDHK       420
     RGGAWMDDCM GRKVRASGEL QTPVAYLVCN FNKAIGDKPA LFTHNEVTTL FHEFGHGIHH       480
     MLTQVDAAPV AGINGVAWDA VELPSQFLEN WCYEEQALSF ISGHYETGEP LPKELLDKLL       540
     AAKNYNSGMQ MLRQLEFSLF DFKIHNDYVA GEPCNIQAVL NDVRSRTSVI KAPEFNRFQH       600
     GFSHIFAGGY SAGYYSYKWA EVLSADAYSK FEEEGIFNPE TGRAFMQHIL EKGGSEEPME       660
     LFKNFRGREP NVDALLRHSG IAA                                               683
//

If you have problems or comments...

PBIL Back to PBIL home page