(data stored in ACNUC7421 zone)

EMBL: CR954246.PRMA

CR954246.PRMA        Location/Qualifiers
FT   CDS             complement(360871..361752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="PSHAa0348"
FT                   /product="methylation of 50S ribosomal subunit protein L11
FT                   (ribosomal protein L11 methyltransferase)"
FT                   /function="3.2.3 : RNA modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8226664; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85446"
FT                   /db_xref="GOA:Q3IIC0"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IIC0"
FT                   /protein_id="CAI85446.1"
FT                   /translation="MAWIQIRINANADNADLISDLLVEAGSASVTFIDAKDTPIYEPKI
FT                   GTVQFWADTTVIGLFDANHDMDSVVALLNADKSVAQNLTYKIEQLEDKDWEREWMDNFH
FT                   PIQFGKRLWICPSWRDIPDPDAVNVLLDPGLAFGTGTHATTALCLKWLESQDLTGKTVV
FT                   DFGCGSGILGIAAIKLGAERMIGIDIDPQALEASLDNANRNGVADKLEVYLPENQPEFS
FT                   ADIVVANILAQPLRELHSVILGLLKPGGKIAMSGILTEQAQSVADVYAPFIELDDIAIE
FT                   GDWTRVSGTKKA"
     MAWIQIRINA NADNADLISD LLVEAGSASV TFIDAKDTPI YEPKIGTVQF WADTTVIGLF        60
     DANHDMDSVV ALLNADKSVA QNLTYKIEQL EDKDWEREWM DNFHPIQFGK RLWICPSWRD       120
     IPDPDAVNVL LDPGLAFGTG THATTALCLK WLESQDLTGK TVVDFGCGSG ILGIAAIKLG       180
     AERMIGIDID PQALEASLDN ANRNGVADKL EVYLPENQPE FSADIVVANI LAQPLRELHS       240
     VILGLLKPGG KIAMSGILTE QAQSVADVYA PFIELDDIAI EGDWTRVSGT KKA              293
//

If you have problems or comments...

PBIL Back to PBIL home page