(data stored in ACNUC7421 zone)

EMBL: CR954246.PROA

CR954246.PROA        Location/Qualifiers
FT   CDS             295205..296452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="PSHAa0280"
FT                   /product="Gamma-glutamyl phosphate reductase (GPR)
FT                   (Glutamate-5-semialdehyde dehydrogenase)
FT                   (Glutamyl-gamma-semialdehyde dehydrogenase) (GSA
FT                   dehydrogenase)"
FT                   /function="2.2.1.7 : Other"
FT                   /EC_number="1.2.1.41"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6089111, 3026898; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85379"
FT                   /db_xref="GOA:Q3IEY7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEY7"
FT                   /protein_id="CAI85379.1"
FT                   /translation="MSLITDISRQAAKAAHQLALLDTETKNKVLLDMAAALRAEKAFII
FT                   KENESDLAAARDNNLAAAMVDRLTLNDERVEAMAEGIEVIVSLDDPVGQLRDITERPNG
FT                   IKIRKMRVPLGVVCMIYEARPNVTADAGALCFKSGNSVILRGGKEALKSSQAIASVMHS
FT                   VLAKHNLPEALISVIPDPDRGLLMELMQQRDSIDLIIPRGGEGLINFVTENSTIPVIQH
FT                   FKGVCHLYVDKDADLEVAINLLLNGKTQRTGVCNALEGLVVHQDIANEFLNLCAVVLRQ
FT                   EGVKINADSQAATYFDNATVLGDDEFGEEYLDLEIAIRVVPSFAAAVEHIAQFGSHHTE
FT                   VICTKNAATAELFQRSVDASVVTVNASSRFSDGSQLGLGAEIGIATSKLHAYGPMGLES
FT                   LTTEKYLVNGDGQIRE"
     MSLITDISRQ AAKAAHQLAL LDTETKNKVL LDMAAALRAE KAFIIKENES DLAAARDNNL        60
     AAAMVDRLTL NDERVEAMAE GIEVIVSLDD PVGQLRDITE RPNGIKIRKM RVPLGVVCMI       120
     YEARPNVTAD AGALCFKSGN SVILRGGKEA LKSSQAIASV MHSVLAKHNL PEALISVIPD       180
     PDRGLLMELM QQRDSIDLII PRGGEGLINF VTENSTIPVI QHFKGVCHLY VDKDADLEVA       240
     INLLLNGKTQ RTGVCNALEG LVVHQDIANE FLNLCAVVLR QEGVKINADS QAATYFDNAT       300
     VLGDDEFGEE YLDLEIAIRV VPSFAAAVEH IAQFGSHHTE VICTKNAATA ELFQRSVDAS       360
     VVTVNASSRF SDGSQLGLGA EIGIATSKLH AYGPMGLESL TTEKYLVNGD GQIRE            415
//

If you have problems or comments...

PBIL Back to PBIL home page