(data stored in ACNUC7421 zone)

EMBL: CR954246.PROB

CR954246.PROB        Location/Qualifiers
FT   CDS             294102..295208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="PSHAa0279"
FT                   /product="putative glutamate 5-kinase (Gamma-glutamyl
FT                   kinase)"
FT                   /function="2.2.1.7 : Other"
FT                   /EC_number="2.7.2.11"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 6089111; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85378"
FT                   /db_xref="GOA:Q3IEY8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEY8"
FT                   /protein_id="CAI85378.1"
FT                   /translation="MNKLNWRRIVLKVGSALIAPDQDGCRSRYILTIAQFIVRCRARGI
FT                   EVILVSSGSVAAGAHLFPSDTARSVVMKKAMAAAGQTEMIAMWDRFFDFPSAQLLLTHG
FT                   DLRDHERYQSIRETVFTLLEHGVLPIINENDAVTTDDLKVGDNDNLSAMVAAAADADAL
FT                   LIFSDVDGLYDKNPNLHDDAILLPEIKSIDDSIYAMAGCATSAVGTGGMKTKIEAAEKA
FT                   TSHGISTYIINGFKEETFTRLLAGENPGTIFLPYEKPMQDSVHWMTHTANEQGEVVVDG
FT                   SFDKSLEGETGCIRGDEIMAVHGEFAIGDTILVRSEDGTRLAKATANYSSCLLSFIADN
FT                   EQSEFSEKMQDSIGPVISEKHIALLEKS"
     MNKLNWRRIV LKVGSALIAP DQDGCRSRYI LTIAQFIVRC RARGIEVILV SSGSVAAGAH        60
     LFPSDTARSV VMKKAMAAAG QTEMIAMWDR FFDFPSAQLL LTHGDLRDHE RYQSIRETVF       120
     TLLEHGVLPI INENDAVTTD DLKVGDNDNL SAMVAAAADA DALLIFSDVD GLYDKNPNLH       180
     DDAILLPEIK SIDDSIYAMA GCATSAVGTG GMKTKIEAAE KATSHGISTY IINGFKEETF       240
     TRLLAGENPG TIFLPYEKPM QDSVHWMTHT ANEQGEVVVD GSFDKSLEGE TGCIRGDEIM       300
     AVHGEFAIGD TILVRSEDGT RLAKATANYS SCLLSFIADN EQSEFSEKMQ DSIGPVISEK       360
     HIALLEKS                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page