(data stored in ACNUC7421 zone)

EMBL: CR954246.PSD

CR954246.PSD         Location/Qualifiers
FT   CDS             complement(503857..504684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="PSHAa0486"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3042771, 8244943, 12900013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85582"
FT                   /db_xref="GOA:Q3IFN3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFN3"
FT                   /protein_id="CAI85582.1"
FT                   /translation="MPKHFISRVVGKLAAAKAGVLTTTLIKLFIKQYKVDMSEAKHPDP
FT                   AHYESFNEFFTRPLKDGARPIVADSDIIIHPVDGAISQLGDIVDGQLIQAKGHDYSLQA
FT                   LLGGNKDDTTPFLGGKFATIYLAPKDYHRIHMPIDGTLSKMIYVPGDLFSVNPLTAQNV
FT                   PNLFARNERVVAIFETEIGPLAMVLVGATIVASIETIWAGTVTPPAGSDVFSWNYPTKG
FT                   ENAISLKKGEEMGRFKLGSTVVLAWGDDKADILDDQLPETVTRLGTPFAKIDD"
     MPKHFISRVV GKLAAAKAGV LTTTLIKLFI KQYKVDMSEA KHPDPAHYES FNEFFTRPLK        60
     DGARPIVADS DIIIHPVDGA ISQLGDIVDG QLIQAKGHDY SLQALLGGNK DDTTPFLGGK       120
     FATIYLAPKD YHRIHMPIDG TLSKMIYVPG DLFSVNPLTA QNVPNLFARN ERVVAIFETE       180
     IGPLAMVLVG ATIVASIETI WAGTVTPPAG SDVFSWNYPT KGENAISLKK GEEMGRFKLG       240
     STVVLAWGDD KADILDDQLP ETVTRLGTPF AKIDD                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page