(data stored in ACNUC7421 zone)

EMBL: CR954246.PSPA

CR954246.PSPA        Location/Qualifiers
FT   CDS             516432..517112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="PSHAa0500"
FT                   /product="putative negative regulatory gene for the psp
FT                   operon, phage shock protein A"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 1712397; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85590"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG91"
FT                   /protein_id="CAI85590.1"
FT                   /translation="MGIFNRVTDIVQANIVSILDKAEDPEKSLNLMLSEMQDALTECRI
FT                   TTAALLCEEKTLKRQIENKNNNLVYWQDKAELAIERGRDDLAKSALLEKQTISNTVVAK
FT                   QLQLETLQQSIAKMTADCQRLQQRIAEAKAKQTQLVQRHNIVAARGQINSQLQSEKVAH
FT                   ALSRFEKVEQRVEGIEAQVEAYELTDSENTIAAQIDALVKNEQVDAELARLKADLKTNL
FT                   KQSA"
     MGIFNRVTDI VQANIVSILD KAEDPEKSLN LMLSEMQDAL TECRITTAAL LCEEKTLKRQ        60
     IENKNNNLVY WQDKAELAIE RGRDDLAKSA LLEKQTISNT VVAKQLQLET LQQSIAKMTA       120
     DCQRLQQRIA EAKAKQTQLV QRHNIVAARG QINSQLQSEK VAHALSRFEK VEQRVEGIEA       180
     QVEAYELTDS ENTIAAQIDA LVKNEQVDAE LARLKADLKT NLKQSA                      226
//

If you have problems or comments...

PBIL Back to PBIL home page