(data stored in ACNUC7421 zone)

EMBL: CR954246.PSPC

CR954246.PSPC        Location/Qualifiers
FT   CDS             517123..517329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pspC"
FT                   /locus_tag="PSHAa0501"
FT                   /product="putative phage shock protein C"
FT                   /function="3.2.1.1 : Regulation"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 1712397"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85591"
FT                   /db_xref="GOA:Q3IG90"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG90"
FT                   /protein_id="CAI85591.1"
FT                   /translation="MNSFNSKRGWYKDPLDKKIFGVCSGLAQRLDLPVWSTRLVTILLF
FT                   LSFPFAIALGYFIAHCCLEEKAI"
     MNSFNSKRGW YKDPLDKKIF GVCSGLAQRL DLPVWSTRLV TILLFLSFPF AIALGYFIAH        60
     CCLEEKAI                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page