(data stored in ACNUC7421 zone)

EMBL: CR954246.PSTA

CR954246.PSTA        Location/Qualifiers
FT   CDS             323997..325646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="PSHAa0310"
FT                   /product="putative phosphate transport system permease
FT                   protein"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85409"
FT                   /db_xref="GOA:Q3ILC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC6"
FT                   /protein_id="CAI85409.1"
FT                   /translation="MVKQWFRSGSPWIWMTGGAVSISLISVIGLLAMIAWKGLSFFWPS
FT                   EVVQFELEGSIAKQTIIGEIYDRELVPKARLAATGVDVSAYDREEFERLLIKTGNREYV
FT                   DLDFRWILNTDIKNQSTPTTLAVFERSKNGNFYGYVEGVIEDGQPVTGDKVAYLHKLVE
FT                   RAVDLNDEALDLQNGDIGHINYELERLRLKEKSYLLDNELTDERVAELAEARAELRAEY
FT                   AVLEKQLFALRKQAQRDQVMVKDMRGEIVTIPLYQVLDVWFPNDMSFLTKLGHYFIQLG
FT                   KFVSDDPREANTEGGVFPAIFGTVFMVMLMAVIVTPFGVVAAIYLHEYAAKNAVTKMIR
FT                   IAVINLAGVPSIVYGVFGLGFFVYMLGGSLDQLFYPESSPTPVFGTPGVMWSALTLAIL
FT                   TLPVVIVSTEEGLSRIPSTVRHGSLALGATQAETLWRIVIPMASPAIMTGLILAVARAA
FT                   GEVAPLMLVGVVKMAPTLPLDGNFPYFHLDRKFMHLGFHIYDVGFQSPNVEAARPLVYA
FT                   TAFLLVSVIITLNITAIGIRNHLREKFRSLEL"
     MVKQWFRSGS PWIWMTGGAV SISLISVIGL LAMIAWKGLS FFWPSEVVQF ELEGSIAKQT        60
     IIGEIYDREL VPKARLAATG VDVSAYDREE FERLLIKTGN REYVDLDFRW ILNTDIKNQS       120
     TPTTLAVFER SKNGNFYGYV EGVIEDGQPV TGDKVAYLHK LVERAVDLND EALDLQNGDI       180
     GHINYELERL RLKEKSYLLD NELTDERVAE LAEARAELRA EYAVLEKQLF ALRKQAQRDQ       240
     VMVKDMRGEI VTIPLYQVLD VWFPNDMSFL TKLGHYFIQL GKFVSDDPRE ANTEGGVFPA       300
     IFGTVFMVML MAVIVTPFGV VAAIYLHEYA AKNAVTKMIR IAVINLAGVP SIVYGVFGLG       360
     FFVYMLGGSL DQLFYPESSP TPVFGTPGVM WSALTLAILT LPVVIVSTEE GLSRIPSTVR       420
     HGSLALGATQ AETLWRIVIP MASPAIMTGL ILAVARAAGE VAPLMLVGVV KMAPTLPLDG       480
     NFPYFHLDRK FMHLGFHIYD VGFQSPNVEA ARPLVYATAF LLVSVIITLN ITAIGIRNHL       540
     REKFRSLEL                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page