(data stored in ACNUC7421 zone)

EMBL: CR954246.PSTB

CR954246.PSTB        Location/Qualifiers
FT   CDS             325669..326496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="PSHAa0311"
FT                   /product="Phosphate import ATP-binding protein
FT                   pstB(Phosphate-transporting ATPase)(ABC phosphate
FT                   transporter)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /EC_number="3.6.3.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2993631, 3881386, 8682808; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85410"
FT                   /db_xref="GOA:Q3ILC5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILC5"
FT                   /protein_id="CAI85410.1"
FT                   /translation="MISVAPKVNQANTSLKLDLDNLTTEQTALEIKDLDLYYGDKQALS
FT                   KVNMNIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVDICRIEGEILLHGQNIYDKSVDV
FT                   AALRRNVGMVFQRPNPFPKSIYENVVYGLRLQGIKDKRKLDEVVEQSLRGAALWDEVKD
FT                   RLHDSAFGLSGGQQQRLVIARSIAISPEVLLLDEPTSALDPISTLVIEELINDLKSKFT
FT                   VVIVTHNMQQAARVSDQTAFMYMGELIEYSDTNTLFTTPNKKKTEDYITGRYG"
     MISVAPKVNQ ANTSLKLDLD NLTTEQTALE IKDLDLYYGD KQALSKVNMN IPKGQVTAFI        60
     GPSGCGKSTL LRCINRMNDL VDICRIEGEI LLHGQNIYDK SVDVAALRRN VGMVFQRPNP       120
     FPKSIYENVV YGLRLQGIKD KRKLDEVVEQ SLRGAALWDE VKDRLHDSAF GLSGGQQQRL       180
     VIARSIAISP EVLLLDEPTS ALDPISTLVI EELINDLKSK FTVVIVTHNM QQAARVSDQT       240
     AFMYMGELIE YSDTNTLFTT PNKKKTEDYI TGRYG                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page