(data stored in ACNUC7421 zone)

EMBL: CR954246.PSTC

CR954246.PSTC        Location/Qualifiers
FT   CDS             321748..323982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="PSHAa0309"
FT                   /product="putative phosphate ABC transporter, permease
FT                   protein"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 2993631, 3881386; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85408"
FT                   /db_xref="GOA:Q3ILC7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILC7"
FT                   /protein_id="CAI85408.1"
FT                   /translation="MTSNPNKPTFNTDRSRLFKDRLAQFGITVGGVMVLIALLLIFFYL
FT                   LYIVQPIFESAKVEKRDSFNLTNAEQIVGVGVEEQTEVAYLLSQQGSVDFYSVEKANFG
FT                   KKLKTLEVTLPSDVSSFATSAPFQGQYAYGLENGSVKIVIPKFMVTFPNNERKLTPRLD
FT                   YPLGELALEVDEQGAAIKRFAFSHFEDKTAVVALTADKRVLFSSFVAEENMFSGEVEWL
FT                   VERTELDVAGRVDELLMSPDTTRVFVRSANQIYVYDTRDPSEVEQIQLLSANEENANIV
FT                   AAQLLAGANSLMLANDNGKVSQWFEINTDSGREYQKIRSFETTKQSKLNVFTEFYRRTF
FT                   FTTSSNGELGVYYTTSQAKLWQGKVSEGAIKSFAIAPRANAALIVADNKLTVLEIHNEH
FT                   PEVTWSALWQEVWYEGYPEPGYIWQSTSASDDFESKFSLVPISFGTLKAAFYAMLFAVP
FT                   IAISAAIYTAYFMSSELRKVVKPTVEIMEALPTVILGFLAGLWLAPLIEQHLPAIVGLL
FT                   VLLPLGILATALGWTKLPASIRHKIPEGSHAIILIPVVLFIGWFSFAMSETVELWMFDG
FT                   NVRQYLTNELGMTFDQRNALVVGIAMGFAVIPTIFSIAEDAVFSVPKHLSNGSLALGAT
FT                   QWQTLIRVVLLTASPGIFSAVMMGLGRAVGETMIVLMATGNTPIMDWSVFQGMRTLAAN
FT                   IAVEMPESEVGSSHYRILFLAAFVLFIFTFVFNTIAEFVRQQLREKYSSM"
     MTSNPNKPTF NTDRSRLFKD RLAQFGITVG GVMVLIALLL IFFYLLYIVQ PIFESAKVEK        60
     RDSFNLTNAE QIVGVGVEEQ TEVAYLLSQQ GSVDFYSVEK ANFGKKLKTL EVTLPSDVSS       120
     FATSAPFQGQ YAYGLENGSV KIVIPKFMVT FPNNERKLTP RLDYPLGELA LEVDEQGAAI       180
     KRFAFSHFED KTAVVALTAD KRVLFSSFVA EENMFSGEVE WLVERTELDV AGRVDELLMS       240
     PDTTRVFVRS ANQIYVYDTR DPSEVEQIQL LSANEENANI VAAQLLAGAN SLMLANDNGK       300
     VSQWFEINTD SGREYQKIRS FETTKQSKLN VFTEFYRRTF FTTSSNGELG VYYTTSQAKL       360
     WQGKVSEGAI KSFAIAPRAN AALIVADNKL TVLEIHNEHP EVTWSALWQE VWYEGYPEPG       420
     YIWQSTSASD DFESKFSLVP ISFGTLKAAF YAMLFAVPIA ISAAIYTAYF MSSELRKVVK       480
     PTVEIMEALP TVILGFLAGL WLAPLIEQHL PAIVGLLVLL PLGILATALG WTKLPASIRH       540
     KIPEGSHAII LIPVVLFIGW FSFAMSETVE LWMFDGNVRQ YLTNELGMTF DQRNALVVGI       600
     AMGFAVIPTI FSIAEDAVFS VPKHLSNGSL ALGATQWQTL IRVVLLTASP GIFSAVMMGL       660
     GRAVGETMIV LMATGNTPIM DWSVFQGMRT LAANIAVEMP ESEVGSSHYR ILFLAAFVLF       720
     IFTFVFNTIA EFVRQQLREK YSSM                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page