(data stored in ACNUC7421 zone)

EMBL: CR954246.PTRB

CR954246.PTRB        Location/Qualifiers
FT   CDS             71799..73973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptrB"
FT                   /locus_tag="PSHAa0069"
FT                   /product="oligopeptidase (protease II)"
FT                   /function="2.2.3.1 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.83"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1447164; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85178"
FT                   /db_xref="GOA:Q3IF93"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF93"
FT                   /protein_id="CAI85178.1"
FT                   /translation="MKHIPCVLAISSLAILSGCNQAPEAVQTNVISTTAEQLPQVVAPI
FT                   AKKVPHAMTIHGDTRIDNYYWLRDDERKAADVISYLEAENSYTNTMLAHTQAQQAKLFA
FT                   ELKGRIQKDDDSVPIKKGDYYYSSQTRGNNEYTTYVRSSDFSGANQQVILDVNELAKAH
FT                   DYYAVSGLDVSPNGNLMAYGEDTLSRRIYTVKIKDLSTGRLLQDTLEGTSGNLVWANDN
FT                   KTLYYIKKDLQTLLGYQVYRHTLGTPQANDELVYEETDSSYYTGLSKSKDGTEIYIWHS
FT                   SSTASGMSVLSANNVKAMPQRLIKRQANLEYSISKLGESYYIVTNLNAVNFQLMKVAIN
FT                   KAHDQANWQALIPARDDIKLEGIELFNDYLVYQQREMGQSRQIIRNLSTNQEQLLSFND
FT                   SAYTISAYGNNDINSNKLRVYYTSMTTPGSSYDINLKTTDKTLLKQQAVLGNFNVDNYA
FT                   SERIFINARDGVKVPVSLVYRKDKFKKDATNPLLQYGYGSYGATMDPTFSSARLSLLDR
FT                   GFVFAIAHVRGSQMLGRPWYDDGKLLTKKNTFNDFIDVTKALVEQKYGAKDKIFAQGGS
FT                   AGGLLMGAVANQAPELYKGMVAAVPFVDVVTTMLDESIPLTTNEYGEWGNPNEKEYYEY
FT                   MLSYSPYDQVSKQAYPNMLVTTGLHDSQVQYFEPAKWVAKLRDYKTDDNKLLFKIDMEA
FT                   GHGGASGRFKRLEDTALNYAFMLDLMGIKE"
     MKHIPCVLAI SSLAILSGCN QAPEAVQTNV ISTTAEQLPQ VVAPIAKKVP HAMTIHGDTR        60
     IDNYYWLRDD ERKAADVISY LEAENSYTNT MLAHTQAQQA KLFAELKGRI QKDDDSVPIK       120
     KGDYYYSSQT RGNNEYTTYV RSSDFSGANQ QVILDVNELA KAHDYYAVSG LDVSPNGNLM       180
     AYGEDTLSRR IYTVKIKDLS TGRLLQDTLE GTSGNLVWAN DNKTLYYIKK DLQTLLGYQV       240
     YRHTLGTPQA NDELVYEETD SSYYTGLSKS KDGTEIYIWH SSSTASGMSV LSANNVKAMP       300
     QRLIKRQANL EYSISKLGES YYIVTNLNAV NFQLMKVAIN KAHDQANWQA LIPARDDIKL       360
     EGIELFNDYL VYQQREMGQS RQIIRNLSTN QEQLLSFNDS AYTISAYGNN DINSNKLRVY       420
     YTSMTTPGSS YDINLKTTDK TLLKQQAVLG NFNVDNYASE RIFINARDGV KVPVSLVYRK       480
     DKFKKDATNP LLQYGYGSYG ATMDPTFSSA RLSLLDRGFV FAIAHVRGSQ MLGRPWYDDG       540
     KLLTKKNTFN DFIDVTKALV EQKYGAKDKI FAQGGSAGGL LMGAVANQAP ELYKGMVAAV       600
     PFVDVVTTML DESIPLTTNE YGEWGNPNEK EYYEYMLSYS PYDQVSKQAY PNMLVTTGLH       660
     DSQVQYFEPA KWVAKLRDYK TDDNKLLFKI DMEAGHGGAS GRFKRLEDTA LNYAFMLDLM       720
     GIKE                                                                    724
//

If you have problems or comments...

PBIL Back to PBIL home page