(data stored in ACNUC7421 zone)

EMBL: CR954246.PURA

CR954246.PURA        Location/Qualifiers
FT   CDS             289024..290337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="PSHAa0275"
FT                   /product="adenylosuccinate synthetase"
FT                   /function="2.3.1.1 : Purine ribonucleotide biosynthesis"
FT                   /EC_number="6.3.4.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2123815, 14701822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85374"
FT                   /db_xref="GOA:Q3IEZ3"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEZ3"
FT                   /protein_id="CAI85374.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTDKASLVVRYQGGHNAGHTLV
FT                   IDGEKTVLHLIPSGVLRDNVKCVIGNGVVLSPEALMREIGMLEARGVPVRERLLISAAC
FT                   PLILPFHVALDVARETARGDKPIGTTGRGIGPAYEDKVARRGLRVGDLFNPELFAAKLE
FT                   EVLEYHNFTLVNYYKVDAVDFQKTFDDAMAVADILKAMIVDVTELLDQTRLAGDNILFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGAGFGPLHLDYVLGIIKAYTTRVGSGPFPT
FT                   ELYDGLDKQDPVGKHLGDKGHEFGATTGRLRRTGWLDAVAMRRAVQINSISGFCLTKLD
FT                   VLDGLETLKICTGYKLEDGTVTNVTPLAAEGYEKVTPIYEEMPGWSENTVGVTSLDGLP
FT                   KAAIDYVKRIEELTGVPVDIISTGPDRVETMILRNPFA"
     MGKNVVVLGT QWGDEGKGKV VDLLTDKASL VVRYQGGHNA GHTLVIDGEK TVLHLIPSGV        60
     LRDNVKCVIG NGVVLSPEAL MREIGMLEAR GVPVRERLLI SAACPLILPF HVALDVARET       120
     ARGDKPIGTT GRGIGPAYED KVARRGLRVG DLFNPELFAA KLEEVLEYHN FTLVNYYKVD       180
     AVDFQKTFDD AMAVADILKA MIVDVTELLD QTRLAGDNIL FEGAQGTLLD IDHGTYPYVT       240
     SSNTTAGGVA TGAGFGPLHL DYVLGIIKAY TTRVGSGPFP TELYDGLDKQ DPVGKHLGDK       300
     GHEFGATTGR LRRTGWLDAV AMRRAVQINS ISGFCLTKLD VLDGLETLKI CTGYKLEDGT       360
     VTNVTPLAAE GYEKVTPIYE EMPGWSENTV GVTSLDGLPK AAIDYVKRIE ELTGVPVDII       420
     STGPDRVETM ILRNPFA                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page